Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2778179..2778396 | Replicon | chromosome |
Accession | NZ_CP026067 | ||
Organism | Staphylococcus aureus strain FDAARGOS_21 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | RK79_RS14420 | Protein ID | WP_001802298.1 |
Coordinates | 2778292..2778396 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF2 | ||
Locus tag | - | ||
Coordinates | 2778179..2778234 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK79_RS14400 | 2774310..2774975 | - | 666 | WP_001024091.1 | SDR family oxidoreductase | - |
RK79_RS14405 | 2775127..2775447 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
RK79_RS14410 | 2775449..2776429 | + | 981 | WP_000019739.1 | CDF family zinc efflux transporter CzrB | - |
RK79_RS14415 | 2776695..2777786 | + | 1092 | WP_047213685.1 | hypothetical protein | - |
- | 2778179..2778234 | + | 56 | - | - | Antitoxin |
RK79_RS14420 | 2778292..2778396 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
RK79_RS15025 | 2778557..2779054 | - | 498 | Protein_2677 | recombinase family protein | - |
RK79_RS14430 | 2779104..2780231 | - | 1128 | WP_047213687.1 | SAP domain-containing protein | - |
RK79_RS14435 | 2781280..2782137 | - | 858 | WP_000370936.1 | Cof-type HAD-IIB family hydrolase | - |
RK79_RS14440 | 2782205..2782987 | - | 783 | WP_000908193.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T93048 WP_001802298.1 NZ_CP026067:c2778396-2778292 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T93048 NZ_CP026067:c2778396-2778292 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT93048 NZ_CP026067:2778179-2778234 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|