Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2796913..2797129 | Replicon | chromosome |
Accession | NZ_CP026066 | ||
Organism | Staphylococcus aureus strain FDAARGOS_20 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | - |
Locus tag | RK78_RS14310 | Protein ID | WP_073392962.1 |
Coordinates | 2797025..2797129 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2796913..2796968 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK78_RS14290 | 2793107..2793772 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
RK78_RS14295 | 2793924..2794244 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
RK78_RS14300 | 2794246..2795226 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
RK78_RS14305 | 2795492..2796583 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
- | 2796913..2796968 | + | 56 | - | - | Antitoxin |
RK78_RS14310 | 2797025..2797129 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
RK78_RS14320 | 2797809..2797967 | + | 159 | WP_001792784.1 | hypothetical protein | - |
RK78_RS14330 | 2798626..2799483 | - | 858 | WP_000370937.1 | Cof-type HAD-IIB family hydrolase | - |
RK78_RS14335 | 2799551..2800333 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T93030 WP_073392962.1 NZ_CP026066:c2797129-2797025 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T93030 NZ_CP026066:c2797129-2797025 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGATTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT93030 NZ_CP026066:2796913-2796968 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|