Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2645594..2645893 | Replicon | chromosome |
Accession | NZ_CP026066 | ||
Organism | Staphylococcus aureus strain FDAARGOS_20 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | RK78_RS13510 | Protein ID | WP_011447039.1 |
Coordinates | 2645717..2645893 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2645594..2645649 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK78_RS13465 | 2640925..2641185 | + | 261 | WP_001791826.1 | hypothetical protein | - |
RK78_RS13470 | 2641238..2641588 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
RK78_RS13475 | 2642273..2642722 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
RK78_RS13480 | 2642817..2643152 | - | 336 | Protein_2521 | SH3 domain-containing protein | - |
RK78_RS13490 | 2643802..2644293 | - | 492 | WP_000919350.1 | staphylokinase | - |
RK78_RS13495 | 2644484..2645239 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
RK78_RS13500 | 2645251..2645505 | - | 255 | WP_000611512.1 | phage holin | - |
RK78_RS13505 | 2645557..2645664 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2645586..2645725 | + | 140 | NuclAT_0 | - | - |
- | 2645586..2645725 | + | 140 | NuclAT_0 | - | - |
- | 2645586..2645725 | + | 140 | NuclAT_0 | - | - |
- | 2645586..2645725 | + | 140 | NuclAT_0 | - | - |
- | 2645594..2645649 | + | 56 | - | - | Antitoxin |
RK78_RS13510 | 2645717..2645893 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
RK78_RS13515 | 2646043..2646339 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
RK78_RS13520 | 2646397..2646684 | - | 288 | WP_001040261.1 | hypothetical protein | - |
RK78_RS13525 | 2646731..2646883 | - | 153 | WP_001153681.1 | hypothetical protein | - |
RK78_RS13530 | 2646873..2650658 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2641238..2669631 | 28393 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T93026 WP_011447039.1 NZ_CP026066:c2645893-2645717 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T93026 NZ_CP026066:c2645893-2645717 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT93026 NZ_CP026066:2645594-2645649 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|