Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2490034..2490214 | Replicon | chromosome |
| Accession | NZ_CP026066 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_20 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK78_RS14425 | Protein ID | WP_001801861.1 |
| Coordinates | 2490034..2490129 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2490157..2490214 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK78_RS12475 | 2485178..2485804 | + | 627 | WP_031883263.1 | hypothetical protein | - |
| RK78_RS12480 | 2485845..2486189 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| RK78_RS12485 | 2486287..2486859 | + | 573 | WP_000414222.1 | hypothetical protein | - |
| RK78_RS12490 | 2487008..2488375 | - | 1368 | WP_001093573.1 | FRG domain-containing protein | - |
| RK78_RS12495 | 2488375..2488944 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK78_RS12500 | 2489137..2489583 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| RK78_RS14425 | 2490034..2490129 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2490157..2490214 | - | 58 | - | - | Antitoxin |
| RK78_RS12510 | 2490252..2490353 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| RK78_RS12515 | 2490528..2490971 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| RK78_RS12520 | 2490971..2491414 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| RK78_RS12525 | 2491414..2491856 | - | 443 | Protein_2375 | DUF1433 domain-containing protein | - |
| RK78_RS12530 | 2492381..2494801 | + | 2421 | WP_000182551.1 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93022 WP_001801861.1 NZ_CP026066:2490034-2490129 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93022 NZ_CP026066:2490034-2490129 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT93022 NZ_CP026066:c2490214-2490157 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|