Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 263681..263865 | Replicon | chromosome |
Accession | NZ_CP026066 | ||
Organism | Staphylococcus aureus strain FDAARGOS_20 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | RK78_RS01495 | Protein ID | WP_000482647.1 |
Coordinates | 263758..263865 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 263681..263741 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK78_RS01470 | 259191..259358 | - | 168 | Protein_275 | hypothetical protein | - |
RK78_RS01480 | 259589..261322 | - | 1734 | WP_000486505.1 | ABC transporter ATP-binding protein/permease | - |
RK78_RS01485 | 261347..263110 | - | 1764 | WP_001064829.1 | ABC transporter ATP-binding protein/permease | - |
- | 263681..263741 | + | 61 | - | - | Antitoxin |
RK78_RS01495 | 263758..263865 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
RK78_RS01500 | 263999..264385 | - | 387 | WP_000779351.1 | flippase GtxA | - |
RK78_RS01505 | 264653..265795 | + | 1143 | WP_001176857.1 | glycerate kinase | - |
RK78_RS01510 | 265855..266514 | + | 660 | WP_000831298.1 | membrane protein | - |
RK78_RS01515 | 266696..267907 | + | 1212 | WP_001191920.1 | multidrug effflux MFS transporter | - |
RK78_RS01520 | 268030..268503 | - | 474 | WP_000456496.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T93013 WP_000482647.1 NZ_CP026066:c263865-263758 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T93013 NZ_CP026066:c263865-263758 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT93013 NZ_CP026066:263681-263741 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|