Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2393843..2394023 | Replicon | chromosome |
| Accession | NZ_CP026064 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_19 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK77_RS14915 | Protein ID | WP_001801861.1 |
| Coordinates | 2393928..2394023 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2393843..2393900 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK77_RS12325 | 2388867..2390048 | + | 1182 | WP_000162901.1 | hypothetical protein | - |
| RK77_RS12330 | 2390365..2390664 | - | 300 | WP_000095392.1 | WXG100 family type VII secretion target | - |
| RK77_RS12335 | 2390679..2392292 | - | 1614 | WP_000926708.1 | lipase | - |
| RK77_RS12340 | 2392337..2392777 | + | 441 | WP_000759947.1 | DUF1433 domain-containing protein | - |
| RK77_RS12345 | 2392983..2393360 | + | 378 | WP_001036002.1 | DUF1433 domain-containing protein | - |
| RK77_RS12350 | 2393554..2393726 | + | 173 | Protein_2291 | transposase | - |
| RK77_RS12355 | 2393704..2393805 | - | 102 | WP_001791232.1 | hypothetical protein | - |
| - | 2393843..2393900 | + | 58 | - | - | Antitoxin |
| RK77_RS14915 | 2393928..2394023 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK77_RS12360 | 2394168..2394272 | + | 105 | WP_001670380.1 | transposase | - |
| RK77_RS15030 | 2394446..2394670 | + | 225 | WP_001805677.1 | IS3 family transposase | - |
| RK77_RS12370 | 2394852..2395235 | + | 384 | WP_000070809.1 | hypothetical protein | - |
| RK77_RS12375 | 2395246..2395422 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| RK77_RS12385 | 2395795..2396364 | + | 570 | WP_000864144.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK77_RS12390 | 2396561..2397133 | - | 573 | WP_000414208.1 | hypothetical protein | - |
| RK77_RS12395 | 2397234..2397575 | - | 342 | WP_000627536.1 | DUF3969 family protein | - |
| RK77_RS12400 | 2397616..2398242 | - | 627 | WP_000669029.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk | 2377613..2421171 | 43558 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T93004 WP_001801861.1 NZ_CP026064:c2394023-2393928 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T93004 NZ_CP026064:c2394023-2393928 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT93004 NZ_CP026064:2393843-2393900 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|