Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3683296..3683518 | Replicon | chromosome |
Accession | NZ_CP026027 | ||
Organism | Escherichia coli strain LIM |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | C2H82_RS19150 | Protein ID | WP_000141634.1 |
Coordinates | 3683296..3683403 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3683452..3683518 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C2H82_RS19125 | 3678549..3679301 | - | 753 | Protein_3498 | cellulose biosynthesis protein BcsQ | - |
C2H82_RS19130 | 3679313..3679501 | - | 189 | WP_001063318.1 | YhjR family protein | - |
C2H82_RS19135 | 3679774..3681345 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
C2H82_RS19140 | 3681342..3681533 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
C2H82_RS19145 | 3681530..3683209 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
C2H82_RS19150 | 3683296..3683403 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 3683452..3683518 | + | 67 | - | - | Antitoxin |
C2H82_RS19165 | 3683879..3685150 | + | 1272 | WP_001295225.1 | transporter | - |
C2H82_RS19170 | 3685180..3686184 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
C2H82_RS19175 | 3686181..3687164 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
C2H82_RS19180 | 3687175..3688077 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T92821 WP_000141634.1 NZ_CP026027:c3683403-3683296 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T92821 NZ_CP026027:c3683403-3683296 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT92821 NZ_CP026027:3683452-3683518 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|