92791

Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1268927..1269149 Replicon chromosome
Accession NZ_CP026027
Organism Escherichia coli strain LIM

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag C2H82_RS06670 Protein ID WP_000170963.1
Coordinates 1268927..1269034 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1269082..1269149 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C2H82_RS06640 1264236..1265318 + 1083 WP_000804726.1 peptide chain release factor 1 -
C2H82_RS06645 1265318..1266151 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
C2H82_RS06650 1266148..1266540 + 393 WP_000200374.1 invasion regulator SirB2 -
C2H82_RS06655 1266544..1267353 + 810 WP_001257044.1 invasion regulator SirB1 -
C2H82_RS06660 1267389..1268243 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C2H82_RS06665 1268392..1268499 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1268547..1268613 + 67 NuclAT_34 - -
- 1268547..1268613 + 67 NuclAT_34 - -
- 1268547..1268613 + 67 NuclAT_34 - -
- 1268547..1268613 + 67 NuclAT_34 - -
- 1268547..1268613 + 67 NuclAT_36 - -
- 1268547..1268613 + 67 NuclAT_36 - -
- 1268547..1268613 + 67 NuclAT_36 - -
- 1268547..1268613 + 67 NuclAT_36 - -
- 1268547..1268613 + 67 NuclAT_38 - -
- 1268547..1268613 + 67 NuclAT_38 - -
- 1268547..1268613 + 67 NuclAT_38 - -
- 1268547..1268613 + 67 NuclAT_38 - -
- 1268547..1268613 + 67 NuclAT_40 - -
- 1268547..1268613 + 67 NuclAT_40 - -
- 1268547..1268613 + 67 NuclAT_40 - -
- 1268547..1268613 + 67 NuclAT_40 - -
- 1268547..1268613 + 67 NuclAT_42 - -
- 1268547..1268613 + 67 NuclAT_42 - -
- 1268547..1268613 + 67 NuclAT_42 - -
- 1268547..1268613 + 67 NuclAT_42 - -
- 1268547..1268613 + 67 NuclAT_44 - -
- 1268547..1268613 + 67 NuclAT_44 - -
- 1268547..1268613 + 67 NuclAT_44 - -
- 1268547..1268613 + 67 NuclAT_44 - -
- 1268549..1268614 + 66 NuclAT_18 - -
- 1268549..1268614 + 66 NuclAT_18 - -
- 1268549..1268614 + 66 NuclAT_18 - -
- 1268549..1268614 + 66 NuclAT_18 - -
- 1268549..1268614 + 66 NuclAT_21 - -
- 1268549..1268614 + 66 NuclAT_21 - -
- 1268549..1268614 + 66 NuclAT_21 - -
- 1268549..1268614 + 66 NuclAT_21 - -
- 1268549..1268614 + 66 NuclAT_24 - -
- 1268549..1268614 + 66 NuclAT_24 - -
- 1268549..1268614 + 66 NuclAT_24 - -
- 1268549..1268614 + 66 NuclAT_24 - -
- 1268549..1268614 + 66 NuclAT_27 - -
- 1268549..1268614 + 66 NuclAT_27 - -
- 1268549..1268614 + 66 NuclAT_27 - -
- 1268549..1268614 + 66 NuclAT_27 - -
- 1268549..1268614 + 66 NuclAT_30 - -
- 1268549..1268614 + 66 NuclAT_30 - -
- 1268549..1268614 + 66 NuclAT_30 - -
- 1268549..1268614 + 66 NuclAT_30 - -
- 1268549..1268614 + 66 NuclAT_33 - -
- 1268549..1268614 + 66 NuclAT_33 - -
- 1268549..1268614 + 66 NuclAT_33 - -
- 1268549..1268614 + 66 NuclAT_33 - -
C2H82_RS06670 1268927..1269034 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1269082..1269149 + 68 NuclAT_17 - Antitoxin
- 1269082..1269149 + 68 NuclAT_17 - Antitoxin
- 1269082..1269149 + 68 NuclAT_17 - Antitoxin
- 1269082..1269149 + 68 NuclAT_17 - Antitoxin
- 1269082..1269149 + 68 NuclAT_20 - Antitoxin
- 1269082..1269149 + 68 NuclAT_20 - Antitoxin
- 1269082..1269149 + 68 NuclAT_20 - Antitoxin
- 1269082..1269149 + 68 NuclAT_20 - Antitoxin
- 1269082..1269149 + 68 NuclAT_23 - Antitoxin
- 1269082..1269149 + 68 NuclAT_23 - Antitoxin
- 1269082..1269149 + 68 NuclAT_23 - Antitoxin
- 1269082..1269149 + 68 NuclAT_23 - Antitoxin
- 1269082..1269149 + 68 NuclAT_26 - Antitoxin
- 1269082..1269149 + 68 NuclAT_26 - Antitoxin
- 1269082..1269149 + 68 NuclAT_26 - Antitoxin
- 1269082..1269149 + 68 NuclAT_26 - Antitoxin
- 1269082..1269149 + 68 NuclAT_29 - Antitoxin
- 1269082..1269149 + 68 NuclAT_29 - Antitoxin
- 1269082..1269149 + 68 NuclAT_29 - Antitoxin
- 1269082..1269149 + 68 NuclAT_29 - Antitoxin
- 1269082..1269149 + 68 NuclAT_32 - Antitoxin
- 1269082..1269149 + 68 NuclAT_32 - Antitoxin
- 1269082..1269149 + 68 NuclAT_32 - Antitoxin
- 1269082..1269149 + 68 NuclAT_32 - Antitoxin
- 1269083..1269148 + 66 NuclAT_35 - -
- 1269083..1269148 + 66 NuclAT_35 - -
- 1269083..1269148 + 66 NuclAT_35 - -
- 1269083..1269148 + 66 NuclAT_35 - -
- 1269083..1269148 + 66 NuclAT_37 - -
- 1269083..1269148 + 66 NuclAT_37 - -
- 1269083..1269148 + 66 NuclAT_37 - -
- 1269083..1269148 + 66 NuclAT_37 - -
- 1269083..1269148 + 66 NuclAT_39 - -
- 1269083..1269148 + 66 NuclAT_39 - -
- 1269083..1269148 + 66 NuclAT_39 - -
- 1269083..1269148 + 66 NuclAT_39 - -
- 1269083..1269148 + 66 NuclAT_41 - -
- 1269083..1269148 + 66 NuclAT_41 - -
- 1269083..1269148 + 66 NuclAT_41 - -
- 1269083..1269148 + 66 NuclAT_41 - -
- 1269083..1269148 + 66 NuclAT_43 - -
- 1269083..1269148 + 66 NuclAT_43 - -
- 1269083..1269148 + 66 NuclAT_43 - -
- 1269083..1269148 + 66 NuclAT_43 - -
- 1269083..1269148 + 66 NuclAT_45 - -
- 1269083..1269148 + 66 NuclAT_45 - -
- 1269083..1269148 + 66 NuclAT_45 - -
- 1269083..1269148 + 66 NuclAT_45 - -
C2H82_RS06680 1269462..1269569 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1269617..1269684 + 68 NuclAT_16 - -
- 1269617..1269684 + 68 NuclAT_16 - -
- 1269617..1269684 + 68 NuclAT_16 - -
- 1269617..1269684 + 68 NuclAT_16 - -
- 1269617..1269684 + 68 NuclAT_19 - -
- 1269617..1269684 + 68 NuclAT_19 - -
- 1269617..1269684 + 68 NuclAT_19 - -
- 1269617..1269684 + 68 NuclAT_19 - -
- 1269617..1269684 + 68 NuclAT_22 - -
- 1269617..1269684 + 68 NuclAT_22 - -
- 1269617..1269684 + 68 NuclAT_22 - -
- 1269617..1269684 + 68 NuclAT_22 - -
- 1269617..1269684 + 68 NuclAT_25 - -
- 1269617..1269684 + 68 NuclAT_25 - -
- 1269617..1269684 + 68 NuclAT_25 - -
- 1269617..1269684 + 68 NuclAT_25 - -
- 1269617..1269684 + 68 NuclAT_28 - -
- 1269617..1269684 + 68 NuclAT_28 - -
- 1269617..1269684 + 68 NuclAT_28 - -
- 1269617..1269684 + 68 NuclAT_28 - -
- 1269617..1269684 + 68 NuclAT_31 - -
- 1269617..1269684 + 68 NuclAT_31 - -
- 1269617..1269684 + 68 NuclAT_31 - -
- 1269617..1269684 + 68 NuclAT_31 - -
C2H82_RS06685 1269973..1271073 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
C2H82_RS06690 1271343..1271573 + 231 WP_001146444.1 putative cation transport regulator ChaB -
C2H82_RS06695 1271731..1272426 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
C2H82_RS06700 1272470..1272823 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T92791 WP_000170963.1 NZ_CP026027:c1269034-1268927 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T92791 NZ_CP026027:c1269034-1268927 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT92791 NZ_CP026027:1269082-1269149 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References