Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 824961..825186 | Replicon | chromosome |
Accession | NZ_CP025979 | ||
Organism | Escherichia marmotae strain HT073016 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | C1192_RS04460 | Protein ID | WP_000887491.1 |
Coordinates | 824974..825186 (+) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 824961..825019 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1192_RS04410 | 819970..820170 | + | 201 | WP_000159335.1 | hypothetical protein | - |
C1192_RS04415 | 820139..820515 | - | 377 | Protein_817 | hypothetical protein | - |
C1192_RS04420 | 820515..820667 | - | 153 | WP_000379591.1 | DUF1391 family protein | - |
C1192_RS04425 | 820834..821241 | - | 408 | WP_038354783.1 | DNA-binding transcriptional dual regulator DicA | - |
C1192_RS04430 | 821325..821555 | + | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
C1192_RS04435 | 821539..822060 | + | 522 | WP_038354782.1 | hypothetical protein | - |
C1192_RS04440 | 822041..823006 | + | 966 | WP_038354781.1 | phage O protein family | - |
C1192_RS04445 | 823047..823469 | + | 423 | WP_001151183.1 | DUF977 family protein | - |
C1192_RS04450 | 823466..823699 | + | 234 | WP_001366387.1 | hypothetical protein | - |
C1192_RS04455 | 823753..824418 | + | 666 | WP_001595803.1 | epoxyqueuosine reductase QueH | - |
- | 824961..825019 | - | 59 | - | - | Antitoxin |
C1192_RS04460 | 824974..825186 | + | 213 | WP_000887491.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C1192_RS04465 | 825403..825639 | + | 237 | WP_000980998.1 | hypothetical protein | - |
C1192_RS04475 | 825689..826000 | + | 312 | Protein_828 | IS66 family insertion sequence element accessory protein TnpB | - |
C1192_RS04480 | 826014..827342 | - | 1329 | WP_103194771.1 | IS4-like element IS4 family transposase | - |
C1192_RS04485 | 827427..827804 | + | 378 | Protein_830 | transposase | - |
C1192_RS04490 | 827804..828151 | + | 348 | WP_069906977.1 | IS66 family insertion sequence element accessory protein TnpB | - |
C1192_RS04495 | 828171..829742 | + | 1572 | WP_001756948.1 | IS66 family transposase | - |
C1192_RS04505 | 829866..830144 | + | 279 | WP_023147795.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 809570..857553 | 47983 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7857.40 Da Isoelectric Point: 8.2634
>T92608 WP_000887491.1 NZ_CP025979:824974-825186 [Escherichia marmotae]
MLDTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MLDTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 213 bp
>T92608 NZ_CP025979:824974-825186 [Escherichia marmotae]
ATGCTAGACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGCTAGACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92608 NZ_CP025979:c825019-824961 [Escherichia marmotae]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|