Detailed information of TA system TA092581

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 102767..103020
• Replicon: plasmid pKPGD4
• Accession: NZ_CP025952
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain GD4

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: CXZ11_RS27950
• Protein ID: WP_001312851.1
• Coordinates: 102871..103020 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	102767..102826 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CXZ11_RS27905	98427..98492	-	66	Protein_125	helix-turn-helix domain-containing protein	-
CXZ11_RS27910	98545..99249	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
CXZ11_RS27915	99313..99474	+	162	Protein_127	DNA helicase	-
CXZ11_RS27920	99494..100240	+	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
CXZ11_RS27925	100295..100855	+	561	WP_000139328.1	fertility inhibition protein FinO	-
CXZ11_RS27930	100987..101187	+	201	WP_015059022.1	hypothetical protein	-
CXZ11_RS27935	101573..102172	+	600	WP_032083981.1	hypothetical protein	-
CXZ11_RS27940	102336..102566	+	231	WP_001736714.1	hypothetical protein	-
-	102767..102826	-	60	NuclAT_1	-	Antitoxin
-	102767..102826	-	60	NuclAT_1	-	Antitoxin
-	102767..102826	-	60	NuclAT_1	-	Antitoxin
-	102767..102826	-	60	NuclAT_1	-	Antitoxin
CXZ11_RS27950	102871..103020	+	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
CXZ11_RS27955	103304..103552	+	249	WP_000083837.1	replication regulatory protein RepA	-
CXZ11_RS27965	103797..103871	+	75	WP_001375168.1	RepA leader peptide Tap	-
CXZ11_RS27970	103864..104721	+	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
CXZ11_RS27980	105660..106313	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
CXZ11_RS28635	106406..106663	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
CXZ11_RS27985	106596..106997	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
CXZ11_RS28000	107246..107667	+	422	Protein_140	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2	-	1..170821	170821

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T92581 WP_001312851.1 NZ_CP025952:102871-103020 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T92581 NZ_CP025952:102871-103020 [Klebsiella pneumoniae subsp. pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT92581 NZ_CP025952:c102826-102767 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin