Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 79068..79338 | Replicon | plasmid pKPGD4 |
Accession | NZ_CP025952 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain GD4 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CXZ11_RS28625 | Protein ID | WP_001312861.1 |
Coordinates | 79180..79338 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 79068..79131 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXZ11_RS27740 | 74779..75306 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
CXZ11_RS27745 | 75364..75597 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
CXZ11_RS27750 | 75658..77681 | + | 2024 | Protein_96 | ParB/RepB/Spo0J family partition protein | - |
CXZ11_RS27755 | 77750..78184 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
CXZ11_RS27760 | 78181..78900 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 78912..79136 | + | 225 | NuclAT_0 | - | - |
- | 78912..79136 | + | 225 | NuclAT_0 | - | - |
- | 78912..79136 | + | 225 | NuclAT_0 | - | - |
- | 78912..79136 | + | 225 | NuclAT_0 | - | - |
- | 79068..79131 | - | 64 | - | - | Antitoxin |
CXZ11_RS28625 | 79180..79338 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CXZ11_RS29245 | 79576..79953 | - | 378 | Protein_100 | hypothetical protein | - |
CXZ11_RS27785 | 80253..80549 | + | 297 | WP_001272251.1 | hypothetical protein | - |
CXZ11_RS27790 | 80660..81481 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
CXZ11_RS27795 | 81778..82425 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
CXZ11_RS27800 | 82702..83085 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
CXZ11_RS27805 | 83276..83962 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
CXZ11_RS27810 | 84056..84283 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..170821 | 170821 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T92577 WP_001312861.1 NZ_CP025952:79180-79338 [Klebsiella pneumoniae subsp. pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T92577 NZ_CP025952:79180-79338 [Klebsiella pneumoniae subsp. pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT92577 NZ_CP025952:c79131-79068 [Klebsiella pneumoniae subsp. pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|