Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4764796..4765021 | Replicon | chromosome |
Accession | NZ_CP025920 | ||
Organism | Escherichia coli strain 103605 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW53_RS23695 | Protein ID | WP_000813254.1 |
Coordinates | 4764866..4765021 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4764796..4764854 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW53_RS23665 | 4760261..4761538 | + | 1278 | WP_000625667.1 | DUF2254 domain-containing protein | - |
CXW53_RS23670 | 4761821..4762516 | - | 696 | WP_032190252.1 | hypothetical protein | - |
CXW53_RS23675 | 4762519..4763025 | - | 507 | WP_000130123.1 | hypothetical protein | - |
CXW53_RS23680 | 4763022..4763852 | - | 831 | WP_001399639.1 | ParA family protein | - |
- | 4764796..4764854 | - | 59 | - | - | Antitoxin |
CXW53_RS23695 | 4764866..4765021 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CXW53_RS23700 | 4765188..4765466 | + | 279 | WP_001410105.1 | hypothetical protein | - |
CXW53_RS23705 | 4765468..4766514 | + | 1047 | WP_001265103.1 | DUF968 domain-containing protein | - |
CXW53_RS23710 | 4766527..4766898 | + | 372 | WP_001217451.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW53_RS23715 | 4766888..4767241 | + | 354 | WP_000532207.1 | antitermination protein Q | - |
CXW53_RS23720 | 4767448..4768731 | - | 1284 | WP_000123148.1 | hypothetical protein | - |
CXW53_RS23725 | 4768988..4769182 | + | 195 | WP_001355891.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4741636..4800740 | 59104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92492 WP_000813254.1 NZ_CP025920:4764866-4765021 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92492 NZ_CP025920:4764866-4765021 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92492 NZ_CP025920:c4764854-4764796 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|