Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 208772..208997 | Replicon | chromosome |
Accession | NZ_CP025920 | ||
Organism | Escherichia coli strain 103605 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW53_RS01235 | Protein ID | WP_000813254.1 |
Coordinates | 208772..208927 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 208939..208997 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW53_RS01195 | 204583..204780 | - | 198 | WP_000917767.1 | hypothetical protein | - |
CXW53_RS01200 | 205093..205635 | - | 543 | WP_001398904.1 | DUF1133 family protein | - |
CXW53_RS01205 | 205644..206009 | - | 366 | WP_001297842.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW53_RS01210 | 206010..207065 | - | 1056 | WP_001502278.1 | DUF968 domain-containing protein | - |
CXW53_RS01215 | 207067..207345 | - | 279 | WP_023607105.1 | hypothetical protein | - |
CXW53_RS01220 | 207412..207672 | - | 261 | WP_000701918.1 | hypothetical protein | - |
CXW53_RS01225 | 207873..208358 | - | 486 | WP_000818165.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
CXW53_RS01230 | 208377..208556 | - | 180 | WP_001277775.1 | hypothetical protein | - |
CXW53_RS01235 | 208772..208927 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 208939..208997 | + | 59 | - | - | Antitoxin |
CXW53_RS01240 | 209219..209641 | - | 423 | WP_000160146.1 | hypothetical protein | - |
CXW53_RS01245 | 209745..210157 | - | 413 | Protein_235 | DUF4406 domain-containing protein | - |
CXW53_RS01250 | 210160..210441 | - | 282 | WP_001509842.1 | hypothetical protein | - |
CXW53_RS01255 | 210474..211235 | - | 762 | WP_126130059.1 | DUF1627 domain-containing protein | - |
CXW53_RS01260 | 211257..212003 | - | 747 | WP_000788772.1 | ATP-binding protein | - |
CXW53_RS01265 | 212009..212974 | - | 966 | WP_000054517.1 | hypothetical protein | - |
CXW53_RS01270 | 212955..213476 | - | 522 | WP_000705382.1 | hypothetical protein | - |
CXW53_RS01275 | 213460..213687 | - | 228 | WP_000476985.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 171127..227629 | 56502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92464 WP_000813254.1 NZ_CP025920:c208927-208772 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92464 NZ_CP025920:c208927-208772 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92464 NZ_CP025920:208939-208997 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|