Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47588..47813 | Replicon | chromosome |
| Accession | NZ_CP025920 | ||
| Organism | Escherichia coli strain 103605 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | CXW53_RS00340 | Protein ID | WP_000813254.1 |
| Coordinates | 47588..47743 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 47755..47813 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXW53_RS27045 | 42634..42795 | - | 162 | WP_001355909.1 | hypothetical protein | - |
| CXW53_RS00290 | 42792..42980 | - | 189 | WP_000874243.1 | DUF1737 domain-containing protein | - |
| CXW53_RS00295 | 43241..43576 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
| CXW53_RS00300 | 43857..43988 | - | 132 | WP_000562553.1 | DUF3927 family protein | - |
| CXW53_RS00320 | 44884..45705 | - | 822 | WP_000762892.1 | antitermination protein | - |
| CXW53_RS00325 | 45702..46082 | - | 381 | WP_000140028.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CXW53_RS00330 | 46083..47141 | - | 1059 | WP_001736257.1 | DUF968 domain-containing protein | - |
| CXW53_RS00335 | 47143..47421 | - | 279 | WP_001410105.1 | hypothetical protein | - |
| CXW53_RS00340 | 47588..47743 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 47755..47813 | + | 59 | - | - | Antitoxin |
| CXW53_RS00350 | 48368..49177 | + | 810 | WP_000161640.1 | hypothetical protein | - |
| CXW53_RS00355 | 49324..49746 | - | 423 | WP_001151221.1 | DUF977 family protein | - |
| CXW53_RS00360 | 49787..50857 | - | 1071 | WP_089516821.1 | phage replisome organizer | - |
| CXW53_RS00365 | 50929..51354 | - | 426 | WP_000693867.1 | Rha family transcriptional regulator | - |
| CXW53_RS00370 | 51338..51581 | - | 244 | Protein_64 | hypothetical protein | - |
| CXW53_RS00375 | 51973..52311 | + | 339 | WP_001397087.1 | peptidase S24-like family protein | - |
| CXW53_RS00380 | 52604..52759 | + | 156 | WP_071608135.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 938..62202 | 61264 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92462 WP_000813254.1 NZ_CP025920:c47743-47588 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92462 NZ_CP025920:c47743-47588 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92462 NZ_CP025920:47755-47813 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|