Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3638..3863 | Replicon | chromosome |
Accession | NZ_CP025920 | ||
Organism | Escherichia coli strain 103605 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW53_RS00045 | Protein ID | WP_000813254.1 |
Coordinates | 3638..3793 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3805..3863 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW53_RS00025 | 938..1759 | - | 822 | WP_000762892.1 | antitermination protein | - |
CXW53_RS00030 | 1756..2136 | - | 381 | WP_000140028.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW53_RS00035 | 2178..3192 | - | 1015 | Protein_3 | DUF968 domain-containing protein | - |
CXW53_RS00040 | 3199..3471 | - | 273 | Protein_4 | hypothetical protein | - |
CXW53_RS00045 | 3638..3793 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3805..3863 | + | 59 | - | - | Antitoxin |
CXW53_RS00055 | 4417..5226 | + | 810 | WP_000161640.1 | hypothetical protein | - |
CXW53_RS00060 | 5373..5795 | - | 423 | WP_001151221.1 | DUF977 family protein | - |
CXW53_RS00065 | 5836..6906 | - | 1071 | WP_089516821.1 | phage replisome organizer | - |
CXW53_RS00070 | 6978..7403 | - | 426 | WP_000693867.1 | Rha family transcriptional regulator | - |
CXW53_RS00075 | 7387..7629 | - | 243 | WP_000747951.1 | hypothetical protein | - |
CXW53_RS00080 | 8021..8359 | + | 339 | WP_001397087.1 | peptidase S24-like family protein | - |
CXW53_RS00085 | 8652..8807 | + | 156 | WP_071608135.1 | DUF1391 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 938..62202 | 61264 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92460 WP_000813254.1 NZ_CP025920:c3793-3638 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92460 NZ_CP025920:c3793-3638 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92460 NZ_CP025920:3805-3863 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|