Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4730386..4730611 | Replicon | chromosome |
Accession | NZ_CP025916 | ||
Organism | Escherichia coli strain 120899 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW56_RS23495 | Protein ID | WP_000813254.1 |
Coordinates | 4730456..4730611 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4730386..4730444 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW56_RS23465 | 4725851..4727128 | + | 1278 | WP_000625667.1 | DUF2254 domain-containing protein | - |
CXW56_RS23470 | 4727411..4728106 | - | 696 | WP_032190252.1 | hypothetical protein | - |
CXW56_RS23475 | 4728109..4728615 | - | 507 | WP_000130123.1 | hypothetical protein | - |
CXW56_RS23480 | 4728612..4729442 | - | 831 | WP_001399639.1 | ParA family protein | - |
- | 4730386..4730444 | - | 59 | - | - | Antitoxin |
CXW56_RS23495 | 4730456..4730611 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CXW56_RS23500 | 4730778..4731056 | + | 279 | WP_001410105.1 | hypothetical protein | - |
CXW56_RS23505 | 4731058..4732104 | + | 1047 | WP_001265103.1 | DUF968 domain-containing protein | - |
CXW56_RS23510 | 4732117..4732488 | + | 372 | WP_001217451.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW56_RS23515 | 4732478..4732831 | + | 354 | WP_000532207.1 | antitermination protein Q | - |
CXW56_RS23520 | 4733038..4734321 | - | 1284 | WP_000123148.1 | hypothetical protein | - |
CXW56_RS23525 | 4734578..4734772 | + | 195 | WP_001355891.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4699507..4771999 | 72492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92452 WP_000813254.1 NZ_CP025916:4730456-4730611 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92452 NZ_CP025916:4730456-4730611 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92452 NZ_CP025916:c4730444-4730386 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|