Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 168094..168319 | Replicon | chromosome |
| Accession | NZ_CP025916 | ||
| Organism | Escherichia coli strain 120899 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | CXW56_RS00995 | Protein ID | WP_000813254.1 |
| Coordinates | 168094..168249 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 168261..168319 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXW56_RS00955 | 163905..164102 | - | 198 | WP_000917767.1 | hypothetical protein | - |
| CXW56_RS00960 | 164415..164957 | - | 543 | WP_001398904.1 | DUF1133 family protein | - |
| CXW56_RS00965 | 164966..165331 | - | 366 | WP_001297842.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CXW56_RS00970 | 165332..166387 | - | 1056 | WP_001502278.1 | DUF968 domain-containing protein | - |
| CXW56_RS00975 | 166389..166667 | - | 279 | WP_023607105.1 | hypothetical protein | - |
| CXW56_RS00980 | 166734..166994 | - | 261 | WP_000701918.1 | hypothetical protein | - |
| CXW56_RS00985 | 167195..167680 | - | 486 | WP_000818165.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| CXW56_RS00990 | 167699..167878 | - | 180 | WP_001277775.1 | hypothetical protein | - |
| CXW56_RS00995 | 168094..168249 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 168261..168319 | + | 59 | - | - | Antitoxin |
| CXW56_RS01000 | 168541..168963 | - | 423 | WP_000160146.1 | hypothetical protein | - |
| CXW56_RS01005 | 169067..169479 | - | 413 | Protein_187 | DUF4406 domain-containing protein | - |
| CXW56_RS01010 | 169482..169763 | - | 282 | WP_001509842.1 | hypothetical protein | - |
| CXW56_RS01015 | 169796..170557 | - | 762 | WP_126130059.1 | DUF1627 domain-containing protein | - |
| CXW56_RS01020 | 170579..171325 | - | 747 | WP_000788772.1 | ATP-binding protein | - |
| CXW56_RS01025 | 171331..172296 | - | 966 | WP_000054517.1 | hypothetical protein | - |
| CXW56_RS01030 | 172277..172798 | - | 522 | WP_000705382.1 | hypothetical protein | - |
| CXW56_RS01035 | 172782..173009 | - | 228 | WP_000476985.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 130449..186951 | 56502 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92424 WP_000813254.1 NZ_CP025916:c168249-168094 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92424 NZ_CP025916:c168249-168094 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92424 NZ_CP025916:168261-168319 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|