Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 8803..9028 | Replicon | chromosome |
| Accession | NZ_CP025916 | ||
| Organism | Escherichia coli strain 120899 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | CXW56_RS00110 | Protein ID | WP_000813254.1 |
| Coordinates | 8803..8958 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 8970..9028 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXW56_RS27375 | 3850..4011 | - | 162 | WP_001355909.1 | hypothetical protein | - |
| CXW56_RS00060 | 4008..4196 | - | 189 | WP_000874243.1 | DUF1737 domain-containing protein | - |
| CXW56_RS00065 | 4457..4791 | + | 335 | Protein_8 | anti-adapter protein IraM | - |
| CXW56_RS00070 | 5072..5203 | - | 132 | WP_000562553.1 | DUF3927 family protein | - |
| CXW56_RS00090 | 6099..6920 | - | 822 | WP_000762892.1 | antitermination protein | - |
| CXW56_RS00095 | 6917..7297 | - | 381 | WP_000140028.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CXW56_RS00100 | 7298..8356 | - | 1059 | WP_001736257.1 | DUF968 domain-containing protein | - |
| CXW56_RS00105 | 8358..8636 | - | 279 | WP_001410105.1 | hypothetical protein | - |
| CXW56_RS00110 | 8803..8958 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 8970..9028 | + | 59 | - | - | Antitoxin |
| CXW56_RS00120 | 9583..10392 | + | 810 | WP_000161640.1 | hypothetical protein | - |
| CXW56_RS00125 | 10539..10961 | - | 423 | WP_001151221.1 | DUF977 family protein | - |
| CXW56_RS00130 | 11002..12072 | - | 1071 | WP_089516821.1 | phage replisome organizer | - |
| CXW56_RS00135 | 12144..12569 | - | 426 | WP_000693867.1 | Rha family transcriptional regulator | - |
| CXW56_RS00140 | 12553..12795 | - | 243 | WP_000747951.1 | hypothetical protein | - |
| CXW56_RS00145 | 13187..13525 | + | 339 | WP_001397087.1 | peptidase S24-like family protein | - |
| CXW56_RS00150 | 13818..13973 | + | 156 | WP_071608135.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 39..23416 | 23377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92422 WP_000813254.1 NZ_CP025916:c8958-8803 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92422 NZ_CP025916:c8958-8803 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92422 NZ_CP025916:8970-9028 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|