Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4123340..4123565 | Replicon | chromosome |
Accession | NZ_CP025910 | ||
Organism | Escherichia coli strain 204446 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW77_RS20460 | Protein ID | WP_000813254.1 |
Coordinates | 4123340..4123495 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 4123507..4123565 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW77_RS20420 | 4119151..4119348 | - | 198 | WP_000917767.1 | hypothetical protein | - |
CXW77_RS20425 | 4119661..4120203 | - | 543 | WP_001398904.1 | DUF1133 family protein | - |
CXW77_RS20430 | 4120212..4120577 | - | 366 | WP_001297842.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW77_RS20435 | 4120578..4121633 | - | 1056 | WP_001502278.1 | DUF968 domain-containing protein | - |
CXW77_RS20440 | 4121635..4121913 | - | 279 | WP_023607105.1 | hypothetical protein | - |
CXW77_RS20445 | 4121980..4122240 | - | 261 | WP_000701918.1 | hypothetical protein | - |
CXW77_RS20450 | 4122441..4122926 | - | 486 | WP_000818165.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
CXW77_RS20455 | 4122945..4123124 | - | 180 | WP_001277775.1 | hypothetical protein | - |
CXW77_RS20460 | 4123340..4123495 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 4123507..4123565 | + | 59 | - | - | Antitoxin |
CXW77_RS20465 | 4123787..4124209 | - | 423 | WP_000160146.1 | hypothetical protein | - |
CXW77_RS20470 | 4124313..4124725 | - | 413 | Protein_3928 | DUF4406 domain-containing protein | - |
CXW77_RS20475 | 4124728..4125009 | - | 282 | WP_001509842.1 | hypothetical protein | - |
CXW77_RS20480 | 4125042..4125803 | - | 762 | WP_126130059.1 | DUF1627 domain-containing protein | - |
CXW77_RS20485 | 4125825..4126571 | - | 747 | WP_000788772.1 | ATP-binding protein | - |
CXW77_RS20490 | 4126577..4127542 | - | 966 | WP_000054517.1 | hypothetical protein | - |
CXW77_RS20495 | 4127523..4128044 | - | 522 | WP_000705382.1 | hypothetical protein | - |
CXW77_RS20500 | 4128028..4128255 | - | 228 | WP_000476985.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4082949..4139296 | 56347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92395 WP_000813254.1 NZ_CP025910:c4123495-4123340 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92395 NZ_CP025910:c4123495-4123340 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92395 NZ_CP025910:4123507-4123565 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|