Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3964048..3964273 | Replicon | chromosome |
Accession | NZ_CP025910 | ||
Organism | Escherichia coli strain 204446 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW77_RS19575 | Protein ID | WP_000813254.1 |
Coordinates | 3964048..3964203 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3964215..3964273 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW77_RS27115 | 3959094..3959255 | - | 162 | WP_001355909.1 | hypothetical protein | - |
CXW77_RS19525 | 3959252..3959440 | - | 189 | WP_000874243.1 | DUF1737 domain-containing protein | - |
CXW77_RS19530 | 3959701..3960036 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
CXW77_RS19535 | 3960317..3960448 | - | 132 | WP_000562553.1 | DUF3927 family protein | - |
CXW77_RS19555 | 3961344..3962165 | - | 822 | WP_000762892.1 | antitermination protein | - |
CXW77_RS19560 | 3962162..3962542 | - | 381 | WP_000140028.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW77_RS19565 | 3962543..3963601 | - | 1059 | WP_001736257.1 | DUF968 domain-containing protein | - |
CXW77_RS19570 | 3963603..3963881 | - | 279 | WP_001410105.1 | hypothetical protein | - |
CXW77_RS19575 | 3964048..3964203 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3964215..3964273 | + | 59 | - | - | Antitoxin |
CXW77_RS19585 | 3964828..3965637 | + | 810 | WP_000161640.1 | hypothetical protein | - |
CXW77_RS19590 | 3965784..3966206 | - | 423 | WP_001151221.1 | DUF977 family protein | - |
CXW77_RS19595 | 3966247..3967317 | - | 1071 | WP_089516821.1 | phage replisome organizer | - |
CXW77_RS19600 | 3967389..3967814 | - | 426 | WP_000693867.1 | Rha family transcriptional regulator | - |
CXW77_RS19605 | 3967798..3968041 | - | 244 | Protein_3759 | hypothetical protein | - |
CXW77_RS19610 | 3968433..3968771 | + | 339 | WP_001397087.1 | peptidase S24-like family protein | - |
CXW77_RS19615 | 3969064..3969219 | + | 156 | WP_071608135.1 | DUF1391 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3931049..3976311 | 45262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92393 WP_000813254.1 NZ_CP025910:c3964203-3964048 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92393 NZ_CP025910:c3964203-3964048 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92393 NZ_CP025910:3964215-3964273 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|