Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3591287..3591512 | Replicon | chromosome |
Accession | NZ_CP025910 | ||
Organism | Escherichia coli strain 204446 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXW77_RS17760 | Protein ID | WP_000813254.1 |
Coordinates | 3591357..3591512 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3591287..3591345 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXW77_RS17730 | 3586752..3588029 | + | 1278 | WP_000625667.1 | DUF2254 domain-containing protein | - |
CXW77_RS17735 | 3588312..3589007 | - | 696 | WP_032190252.1 | hypothetical protein | - |
CXW77_RS17740 | 3589010..3589516 | - | 507 | WP_000130123.1 | hypothetical protein | - |
CXW77_RS17745 | 3589513..3590343 | - | 831 | WP_001399639.1 | ParA family protein | - |
- | 3591287..3591345 | - | 59 | - | - | Antitoxin |
CXW77_RS17760 | 3591357..3591512 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
CXW77_RS17765 | 3591679..3591957 | + | 279 | WP_001410105.1 | hypothetical protein | - |
CXW77_RS17770 | 3591959..3593005 | + | 1047 | WP_001265103.1 | DUF968 domain-containing protein | - |
CXW77_RS17775 | 3593018..3593389 | + | 372 | WP_001217451.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXW77_RS17780 | 3593379..3593732 | + | 354 | WP_000532207.1 | antitermination protein Q | - |
CXW77_RS17785 | 3593939..3595222 | - | 1284 | WP_000123148.1 | hypothetical protein | - |
CXW77_RS17790 | 3595479..3595673 | + | 195 | WP_001355891.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3565688..3629883 | 64195 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92390 WP_000813254.1 NZ_CP025910:3591357-3591512 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92390 NZ_CP025910:3591357-3591512 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92390 NZ_CP025910:c3591345-3591287 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|