Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2135795..2136020 | Replicon | chromosome |
Accession | NZ_CP025862 | ||
Organism | Escherichia coli strain 504237 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | CXX10_RS10515 | Protein ID | WP_000813254.1 |
Coordinates | 2135795..2135950 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2135962..2136020 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXX10_RS10485 | 2131634..2131828 | - | 195 | WP_001355891.1 | hypothetical protein | - |
CXX10_RS10490 | 2132085..2133368 | + | 1284 | WP_000123148.1 | hypothetical protein | - |
CXX10_RS10495 | 2133575..2133928 | - | 354 | WP_000532207.1 | antitermination protein Q | - |
CXX10_RS10500 | 2133918..2134289 | - | 372 | WP_001217451.1 | RusA family crossover junction endodeoxyribonuclease | - |
CXX10_RS10505 | 2134302..2135348 | - | 1047 | WP_126123775.1 | DUF968 domain-containing protein | - |
CXX10_RS10510 | 2135350..2135628 | - | 279 | WP_001410105.1 | hypothetical protein | - |
CXX10_RS10515 | 2135795..2135950 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2135962..2136020 | + | 59 | - | - | Antitoxin |
CXX10_RS10530 | 2136964..2137794 | + | 831 | WP_001399639.1 | ParA family protein | - |
CXX10_RS10535 | 2137791..2138297 | + | 507 | WP_000130123.1 | hypothetical protein | - |
CXX10_RS10540 | 2138300..2138995 | + | 696 | WP_032190252.1 | hypothetical protein | - |
CXX10_RS10545 | 2139278..2140555 | - | 1278 | WP_000625667.1 | DUF2254 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2100076..2155273 | 55197 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92222 WP_000813254.1 NZ_CP025862:c2135950-2135795 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92222 NZ_CP025862:c2135950-2135795 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92222 NZ_CP025862:2135962-2136020 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|