Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1710094..1710315 Replicon chromosome
Accession NZ_CP025862
Organism Escherichia coli strain 504237

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag CXX10_RS08395 Protein ID WP_000170954.1
Coordinates 1710094..1710201 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1710249..1710315 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CXX10_RS08370 1705938..1707020 + 1083 WP_000804726.1 peptide chain release factor 1 -
CXX10_RS08375 1707020..1707853 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
CXX10_RS08380 1707850..1708242 + 393 WP_000200392.1 invasion regulator SirB2 -
CXX10_RS08385 1708246..1709055 + 810 WP_001257044.1 invasion regulator SirB1 -
CXX10_RS08390 1709091..1709945 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CXX10_RS08395 1710094..1710201 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1710249..1710315 + 67 NuclAT_28 - Antitoxin
- 1710249..1710315 + 67 NuclAT_28 - Antitoxin
- 1710249..1710315 + 67 NuclAT_28 - Antitoxin
- 1710249..1710315 + 67 NuclAT_28 - Antitoxin
- 1710249..1710315 + 67 NuclAT_30 - Antitoxin
- 1710249..1710315 + 67 NuclAT_30 - Antitoxin
- 1710249..1710315 + 67 NuclAT_30 - Antitoxin
- 1710249..1710315 + 67 NuclAT_30 - Antitoxin
- 1710249..1710315 + 67 NuclAT_32 - Antitoxin
- 1710249..1710315 + 67 NuclAT_32 - Antitoxin
- 1710249..1710315 + 67 NuclAT_32 - Antitoxin
- 1710249..1710315 + 67 NuclAT_32 - Antitoxin
- 1710249..1710315 + 67 NuclAT_34 - Antitoxin
- 1710249..1710315 + 67 NuclAT_34 - Antitoxin
- 1710249..1710315 + 67 NuclAT_34 - Antitoxin
- 1710249..1710315 + 67 NuclAT_34 - Antitoxin
- 1710249..1710315 + 67 NuclAT_36 - Antitoxin
- 1710249..1710315 + 67 NuclAT_36 - Antitoxin
- 1710249..1710315 + 67 NuclAT_36 - Antitoxin
- 1710249..1710315 + 67 NuclAT_36 - Antitoxin
- 1710249..1710315 + 67 NuclAT_38 - Antitoxin
- 1710249..1710315 + 67 NuclAT_38 - Antitoxin
- 1710249..1710315 + 67 NuclAT_38 - Antitoxin
- 1710249..1710315 + 67 NuclAT_38 - Antitoxin
- 1710251..1710314 + 64 NuclAT_41 - -
- 1710251..1710314 + 64 NuclAT_41 - -
- 1710251..1710314 + 64 NuclAT_41 - -
- 1710251..1710314 + 64 NuclAT_41 - -
CXX10_RS08400 1710629..1710736 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1710789..1710850 + 62 NuclAT_40 - -
- 1710789..1710850 + 62 NuclAT_40 - -
- 1710789..1710850 + 62 NuclAT_40 - -
- 1710789..1710850 + 62 NuclAT_40 - -
- 1710789..1710851 + 63 NuclAT_29 - -
- 1710789..1710851 + 63 NuclAT_29 - -
- 1710789..1710851 + 63 NuclAT_29 - -
- 1710789..1710851 + 63 NuclAT_29 - -
- 1710789..1710851 + 63 NuclAT_31 - -
- 1710789..1710851 + 63 NuclAT_31 - -
- 1710789..1710851 + 63 NuclAT_31 - -
- 1710789..1710851 + 63 NuclAT_31 - -
- 1710789..1710851 + 63 NuclAT_33 - -
- 1710789..1710851 + 63 NuclAT_33 - -
- 1710789..1710851 + 63 NuclAT_33 - -
- 1710789..1710851 + 63 NuclAT_33 - -
- 1710789..1710851 + 63 NuclAT_35 - -
- 1710789..1710851 + 63 NuclAT_35 - -
- 1710789..1710851 + 63 NuclAT_35 - -
- 1710789..1710851 + 63 NuclAT_35 - -
- 1710789..1710851 + 63 NuclAT_37 - -
- 1710789..1710851 + 63 NuclAT_37 - -
- 1710789..1710851 + 63 NuclAT_37 - -
- 1710789..1710851 + 63 NuclAT_37 - -
- 1710789..1710851 + 63 NuclAT_39 - -
- 1710789..1710851 + 63 NuclAT_39 - -
- 1710789..1710851 + 63 NuclAT_39 - -
- 1710789..1710851 + 63 NuclAT_39 - -
- 1710789..1710852 + 64 NuclAT_17 - -
- 1710789..1710852 + 64 NuclAT_17 - -
- 1710789..1710852 + 64 NuclAT_17 - -
- 1710789..1710852 + 64 NuclAT_17 - -
- 1710789..1710852 + 64 NuclAT_19 - -
- 1710789..1710852 + 64 NuclAT_19 - -
- 1710789..1710852 + 64 NuclAT_19 - -
- 1710789..1710852 + 64 NuclAT_19 - -
- 1710789..1710852 + 64 NuclAT_21 - -
- 1710789..1710852 + 64 NuclAT_21 - -
- 1710789..1710852 + 64 NuclAT_21 - -
- 1710789..1710852 + 64 NuclAT_21 - -
- 1710789..1710852 + 64 NuclAT_23 - -
- 1710789..1710852 + 64 NuclAT_23 - -
- 1710789..1710852 + 64 NuclAT_23 - -
- 1710789..1710852 + 64 NuclAT_23 - -
- 1710789..1710852 + 64 NuclAT_25 - -
- 1710789..1710852 + 64 NuclAT_25 - -
- 1710789..1710852 + 64 NuclAT_25 - -
- 1710789..1710852 + 64 NuclAT_25 - -
- 1710789..1710852 + 64 NuclAT_27 - -
- 1710789..1710852 + 64 NuclAT_27 - -
- 1710789..1710852 + 64 NuclAT_27 - -
- 1710789..1710852 + 64 NuclAT_27 - -
CXX10_RS08405 1711165..1711272 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1711320..1711387 + 68 NuclAT_16 - -
- 1711320..1711387 + 68 NuclAT_16 - -
- 1711320..1711387 + 68 NuclAT_16 - -
- 1711320..1711387 + 68 NuclAT_16 - -
- 1711320..1711387 + 68 NuclAT_18 - -
- 1711320..1711387 + 68 NuclAT_18 - -
- 1711320..1711387 + 68 NuclAT_18 - -
- 1711320..1711387 + 68 NuclAT_18 - -
- 1711320..1711387 + 68 NuclAT_20 - -
- 1711320..1711387 + 68 NuclAT_20 - -
- 1711320..1711387 + 68 NuclAT_20 - -
- 1711320..1711387 + 68 NuclAT_20 - -
- 1711320..1711387 + 68 NuclAT_22 - -
- 1711320..1711387 + 68 NuclAT_22 - -
- 1711320..1711387 + 68 NuclAT_22 - -
- 1711320..1711387 + 68 NuclAT_22 - -
- 1711320..1711387 + 68 NuclAT_24 - -
- 1711320..1711387 + 68 NuclAT_24 - -
- 1711320..1711387 + 68 NuclAT_24 - -
- 1711320..1711387 + 68 NuclAT_24 - -
- 1711320..1711387 + 68 NuclAT_26 - -
- 1711320..1711387 + 68 NuclAT_26 - -
- 1711320..1711387 + 68 NuclAT_26 - -
- 1711320..1711387 + 68 NuclAT_26 - -
CXX10_RS08410 1711677..1712777 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CXX10_RS08415 1713047..1713277 + 231 WP_001146442.1 putative cation transport regulator ChaB -
CXX10_RS08420 1713435..1714130 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
CXX10_RS08425 1714174..1714527 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T92213 WP_000170954.1 NZ_CP025862:c1710201-1710094 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T92213 NZ_CP025862:c1710201-1710094 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT92213 NZ_CP025862:1710249-1710315 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References