Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1603742..1603967 | Replicon | chromosome |
| Accession | NZ_CP025862 | ||
| Organism | Escherichia coli strain 504237 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | CXX10_RS07800 | Protein ID | WP_000813254.1 |
| Coordinates | 1603812..1603967 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1603742..1603800 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXX10_RS07760 | 1599052..1599279 | + | 228 | WP_000476985.1 | transcriptional regulator | - |
| CXX10_RS07765 | 1599263..1599784 | + | 522 | WP_000705382.1 | hypothetical protein | - |
| CXX10_RS07770 | 1599765..1600730 | + | 966 | WP_000054517.1 | hypothetical protein | - |
| CXX10_RS07775 | 1600736..1601482 | + | 747 | WP_000788772.1 | ATP-binding protein | - |
| CXX10_RS07780 | 1601504..1602265 | + | 762 | WP_000450703.1 | DUF1627 domain-containing protein | - |
| CXX10_RS07785 | 1602298..1602579 | + | 282 | WP_001509842.1 | hypothetical protein | - |
| CXX10_RS07790 | 1602582..1602994 | + | 413 | Protein_1494 | DUF4406 domain-containing protein | - |
| CXX10_RS07795 | 1603098..1603520 | + | 423 | WP_000160146.1 | hypothetical protein | - |
| - | 1603742..1603800 | - | 59 | - | - | Antitoxin |
| CXX10_RS07800 | 1603812..1603967 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| CXX10_RS07805 | 1604183..1604362 | + | 180 | WP_001277775.1 | hypothetical protein | - |
| CXX10_RS07810 | 1604381..1604866 | + | 486 | WP_000818165.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
| CXX10_RS07815 | 1605067..1605327 | + | 261 | WP_000701918.1 | hypothetical protein | - |
| CXX10_RS07820 | 1605394..1605672 | + | 279 | WP_023607105.1 | hypothetical protein | - |
| CXX10_RS07825 | 1605674..1606729 | + | 1056 | WP_001502278.1 | DUF968 domain-containing protein | - |
| CXX10_RS07830 | 1606730..1607095 | + | 366 | WP_001297842.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CXX10_RS07835 | 1607104..1607646 | + | 543 | WP_001398904.1 | DUF1133 family protein | - |
| CXX10_RS07840 | 1607959..1608156 | + | 198 | WP_000917767.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1585110..1644358 | 59248 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T92211 WP_000813254.1 NZ_CP025862:1603812-1603967 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T92211 NZ_CP025862:1603812-1603967 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT92211 NZ_CP025862:c1603800-1603742 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|