Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1701..1954 | Replicon | plasmid p504838_108 |
| Accession | NZ_CP025857 | ||
| Organism | Escherichia coli strain 504838 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | CXV93_RS25420 | Protein ID | WP_001336447.1 |
| Coordinates | 1701..1850 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 1898..1954 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXV93_RS25400 | 1..858 | - | 858 | WP_001537577.1 | incFII family plasmid replication initiator RepA | - |
| CXV93_RS25405 | 851..925 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| CXV93_RS25415 | 1159..1416 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| CXV93_RS25420 | 1701..1850 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 1898..1954 | + | 57 | NuclAT_2 | - | Antitoxin |
| - | 1898..1954 | + | 57 | NuclAT_2 | - | Antitoxin |
| - | 1898..1954 | + | 57 | NuclAT_2 | - | Antitoxin |
| - | 1898..1954 | + | 57 | NuclAT_2 | - | Antitoxin |
| CXV93_RS25430 | 2049..2486 | - | 438 | WP_000872609.1 | hypothetical protein | - |
| CXV93_RS25435 | 2639..3022 | - | 384 | WP_001109264.1 | hypothetical protein | - |
| CXV93_RS25440 | 3084..3781 | + | 698 | Protein_6 | IS1 family transposase | - |
| CXV93_RS25445 | 3902..4363 | - | 462 | WP_000760080.1 | thermonuclease family protein | - |
| CXV93_RS25450 | 5116..5319 | - | 204 | WP_001336517.1 | hypothetical protein | - |
| CXV93_RS25455 | 5471..6028 | - | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| CXV93_RS25460 | 6083..6829 | - | 747 | WP_000205709.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | cofA | 1..108475 | 108475 | |
| - | flank | IS/Tn | - | - | 3404..3781 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T92163 WP_001336447.1 NZ_CP025857:c1850-1701 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T92163 NZ_CP025857:c1850-1701 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT92163 NZ_CP025857:1898-1954 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|