Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 3979231..3979453 Replicon chromosome
Accession NZ_CP025847
Organism Escherichia coli strain 602354

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag CXX15_RS19320 Protein ID WP_000170965.1
Coordinates 3979231..3979338 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 3979386..3979453 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CXX15_RS19290 3975086..3975919 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
CXX15_RS19295 3975916..3976308 + 393 WP_000200392.1 invasion regulator SirB2 -
CXX15_RS19300 3976312..3977121 + 810 WP_001257044.1 invasion regulator SirB1 -
CXX15_RS19305 3977157..3978011 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CXX15_RS19310 3978160..3978267 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3978315..3978381 + 67 NuclAT_28 - -
- 3978315..3978381 + 67 NuclAT_28 - -
- 3978315..3978381 + 67 NuclAT_28 - -
- 3978315..3978381 + 67 NuclAT_28 - -
- 3978315..3978381 + 67 NuclAT_30 - -
- 3978315..3978381 + 67 NuclAT_30 - -
- 3978315..3978381 + 67 NuclAT_30 - -
- 3978315..3978381 + 67 NuclAT_30 - -
- 3978315..3978381 + 67 NuclAT_32 - -
- 3978315..3978381 + 67 NuclAT_32 - -
- 3978315..3978381 + 67 NuclAT_32 - -
- 3978315..3978381 + 67 NuclAT_32 - -
- 3978315..3978381 + 67 NuclAT_34 - -
- 3978315..3978381 + 67 NuclAT_34 - -
- 3978315..3978381 + 67 NuclAT_34 - -
- 3978315..3978381 + 67 NuclAT_34 - -
- 3978315..3978381 + 67 NuclAT_36 - -
- 3978315..3978381 + 67 NuclAT_36 - -
- 3978315..3978381 + 67 NuclAT_36 - -
- 3978315..3978381 + 67 NuclAT_36 - -
- 3978315..3978381 + 67 NuclAT_38 - -
- 3978315..3978381 + 67 NuclAT_38 - -
- 3978315..3978381 + 67 NuclAT_38 - -
- 3978315..3978381 + 67 NuclAT_38 - -
- 3978317..3978380 + 64 NuclAT_41 - -
- 3978317..3978380 + 64 NuclAT_41 - -
- 3978317..3978380 + 64 NuclAT_41 - -
- 3978317..3978380 + 64 NuclAT_41 - -
CXX15_RS19315 3978695..3978802 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3978855..3978916 + 62 NuclAT_40 - -
- 3978855..3978916 + 62 NuclAT_40 - -
- 3978855..3978916 + 62 NuclAT_40 - -
- 3978855..3978916 + 62 NuclAT_40 - -
- 3978855..3978917 + 63 NuclAT_29 - -
- 3978855..3978917 + 63 NuclAT_29 - -
- 3978855..3978917 + 63 NuclAT_29 - -
- 3978855..3978917 + 63 NuclAT_29 - -
- 3978855..3978917 + 63 NuclAT_31 - -
- 3978855..3978917 + 63 NuclAT_31 - -
- 3978855..3978917 + 63 NuclAT_31 - -
- 3978855..3978917 + 63 NuclAT_31 - -
- 3978855..3978917 + 63 NuclAT_33 - -
- 3978855..3978917 + 63 NuclAT_33 - -
- 3978855..3978917 + 63 NuclAT_33 - -
- 3978855..3978917 + 63 NuclAT_33 - -
- 3978855..3978917 + 63 NuclAT_35 - -
- 3978855..3978917 + 63 NuclAT_35 - -
- 3978855..3978917 + 63 NuclAT_35 - -
- 3978855..3978917 + 63 NuclAT_35 - -
- 3978855..3978917 + 63 NuclAT_37 - -
- 3978855..3978917 + 63 NuclAT_37 - -
- 3978855..3978917 + 63 NuclAT_37 - -
- 3978855..3978917 + 63 NuclAT_37 - -
- 3978855..3978917 + 63 NuclAT_39 - -
- 3978855..3978917 + 63 NuclAT_39 - -
- 3978855..3978917 + 63 NuclAT_39 - -
- 3978855..3978917 + 63 NuclAT_39 - -
- 3978855..3978918 + 64 NuclAT_17 - -
- 3978855..3978918 + 64 NuclAT_17 - -
- 3978855..3978918 + 64 NuclAT_17 - -
- 3978855..3978918 + 64 NuclAT_17 - -
- 3978855..3978918 + 64 NuclAT_19 - -
- 3978855..3978918 + 64 NuclAT_19 - -
- 3978855..3978918 + 64 NuclAT_19 - -
- 3978855..3978918 + 64 NuclAT_19 - -
- 3978855..3978918 + 64 NuclAT_21 - -
- 3978855..3978918 + 64 NuclAT_21 - -
- 3978855..3978918 + 64 NuclAT_21 - -
- 3978855..3978918 + 64 NuclAT_21 - -
- 3978855..3978918 + 64 NuclAT_23 - -
- 3978855..3978918 + 64 NuclAT_23 - -
- 3978855..3978918 + 64 NuclAT_23 - -
- 3978855..3978918 + 64 NuclAT_23 - -
- 3978855..3978918 + 64 NuclAT_25 - -
- 3978855..3978918 + 64 NuclAT_25 - -
- 3978855..3978918 + 64 NuclAT_25 - -
- 3978855..3978918 + 64 NuclAT_25 - -
- 3978855..3978918 + 64 NuclAT_27 - -
- 3978855..3978918 + 64 NuclAT_27 - -
- 3978855..3978918 + 64 NuclAT_27 - -
- 3978855..3978918 + 64 NuclAT_27 - -
CXX15_RS19320 3979231..3979338 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3979386..3979453 + 68 NuclAT_16 - Antitoxin
- 3979386..3979453 + 68 NuclAT_16 - Antitoxin
- 3979386..3979453 + 68 NuclAT_16 - Antitoxin
- 3979386..3979453 + 68 NuclAT_16 - Antitoxin
- 3979386..3979453 + 68 NuclAT_18 - Antitoxin
- 3979386..3979453 + 68 NuclAT_18 - Antitoxin
- 3979386..3979453 + 68 NuclAT_18 - Antitoxin
- 3979386..3979453 + 68 NuclAT_18 - Antitoxin
- 3979386..3979453 + 68 NuclAT_20 - Antitoxin
- 3979386..3979453 + 68 NuclAT_20 - Antitoxin
- 3979386..3979453 + 68 NuclAT_20 - Antitoxin
- 3979386..3979453 + 68 NuclAT_20 - Antitoxin
- 3979386..3979453 + 68 NuclAT_22 - Antitoxin
- 3979386..3979453 + 68 NuclAT_22 - Antitoxin
- 3979386..3979453 + 68 NuclAT_22 - Antitoxin
- 3979386..3979453 + 68 NuclAT_22 - Antitoxin
- 3979386..3979453 + 68 NuclAT_24 - Antitoxin
- 3979386..3979453 + 68 NuclAT_24 - Antitoxin
- 3979386..3979453 + 68 NuclAT_24 - Antitoxin
- 3979386..3979453 + 68 NuclAT_24 - Antitoxin
- 3979386..3979453 + 68 NuclAT_26 - Antitoxin
- 3979386..3979453 + 68 NuclAT_26 - Antitoxin
- 3979386..3979453 + 68 NuclAT_26 - Antitoxin
- 3979386..3979453 + 68 NuclAT_26 - Antitoxin
CXX15_RS19325 3979743..3980843 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CXX15_RS19330 3981113..3981343 + 231 WP_001146442.1 putative cation transport regulator ChaB -
CXX15_RS19335 3981501..3982196 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
CXX15_RS19340 3982240..3982593 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CXX15_RS19345 3982778..3984172 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T92071 WP_000170965.1 NZ_CP025847:c3979338-3979231 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T92071 NZ_CP025847:c3979338-3979231 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT92071 NZ_CP025847:3979386-3979453 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References