Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2028204..2028426 Replicon chromosome
Accession NZ_CP025747
Organism Escherichia coli strain ML35

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag C1I23_RS10785 Protein ID WP_000170955.1
Coordinates 2028204..2028311 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2028359..2028426 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C1I23_RS10750 2024060..2024893 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
C1I23_RS10755 2024890..2025282 + 393 WP_000200374.1 invasion regulator SirB2 -
C1I23_RS10760 2025286..2026095 + 810 WP_001257044.1 invasion regulator SirB1 -
C1I23_RS10765 2026131..2026985 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C1I23_RS10770 2027134..2027241 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2027289..2027355 + 67 NuclAT_33 - -
- 2027289..2027355 + 67 NuclAT_33 - -
- 2027289..2027355 + 67 NuclAT_33 - -
- 2027289..2027355 + 67 NuclAT_33 - -
- 2027289..2027355 + 67 NuclAT_35 - -
- 2027289..2027355 + 67 NuclAT_35 - -
- 2027289..2027355 + 67 NuclAT_35 - -
- 2027289..2027355 + 67 NuclAT_35 - -
- 2027289..2027355 + 67 NuclAT_37 - -
- 2027289..2027355 + 67 NuclAT_37 - -
- 2027289..2027355 + 67 NuclAT_37 - -
- 2027289..2027355 + 67 NuclAT_37 - -
- 2027289..2027355 + 67 NuclAT_39 - -
- 2027289..2027355 + 67 NuclAT_39 - -
- 2027289..2027355 + 67 NuclAT_39 - -
- 2027289..2027355 + 67 NuclAT_39 - -
- 2027289..2027355 + 67 NuclAT_41 - -
- 2027289..2027355 + 67 NuclAT_41 - -
- 2027289..2027355 + 67 NuclAT_41 - -
- 2027289..2027355 + 67 NuclAT_41 - -
- 2027289..2027355 + 67 NuclAT_43 - -
- 2027289..2027355 + 67 NuclAT_43 - -
- 2027289..2027355 + 67 NuclAT_43 - -
- 2027289..2027355 + 67 NuclAT_43 - -
- 2027291..2027356 + 66 NuclAT_17 - -
- 2027291..2027356 + 66 NuclAT_17 - -
- 2027291..2027356 + 66 NuclAT_17 - -
- 2027291..2027356 + 66 NuclAT_17 - -
- 2027291..2027356 + 66 NuclAT_20 - -
- 2027291..2027356 + 66 NuclAT_20 - -
- 2027291..2027356 + 66 NuclAT_20 - -
- 2027291..2027356 + 66 NuclAT_20 - -
- 2027291..2027356 + 66 NuclAT_23 - -
- 2027291..2027356 + 66 NuclAT_23 - -
- 2027291..2027356 + 66 NuclAT_23 - -
- 2027291..2027356 + 66 NuclAT_23 - -
- 2027291..2027356 + 66 NuclAT_26 - -
- 2027291..2027356 + 66 NuclAT_26 - -
- 2027291..2027356 + 66 NuclAT_26 - -
- 2027291..2027356 + 66 NuclAT_26 - -
- 2027291..2027356 + 66 NuclAT_29 - -
- 2027291..2027356 + 66 NuclAT_29 - -
- 2027291..2027356 + 66 NuclAT_29 - -
- 2027291..2027356 + 66 NuclAT_29 - -
- 2027291..2027356 + 66 NuclAT_32 - -
- 2027291..2027356 + 66 NuclAT_32 - -
- 2027291..2027356 + 66 NuclAT_32 - -
- 2027291..2027356 + 66 NuclAT_32 - -
C1I23_RS10775 2027669..2027776 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2027824..2027891 + 68 NuclAT_16 - -
- 2027824..2027891 + 68 NuclAT_16 - -
- 2027824..2027891 + 68 NuclAT_16 - -
- 2027824..2027891 + 68 NuclAT_16 - -
- 2027824..2027891 + 68 NuclAT_19 - -
- 2027824..2027891 + 68 NuclAT_19 - -
- 2027824..2027891 + 68 NuclAT_19 - -
- 2027824..2027891 + 68 NuclAT_19 - -
- 2027824..2027891 + 68 NuclAT_22 - -
- 2027824..2027891 + 68 NuclAT_22 - -
- 2027824..2027891 + 68 NuclAT_22 - -
- 2027824..2027891 + 68 NuclAT_22 - -
- 2027824..2027891 + 68 NuclAT_25 - -
- 2027824..2027891 + 68 NuclAT_25 - -
- 2027824..2027891 + 68 NuclAT_25 - -
- 2027824..2027891 + 68 NuclAT_25 - -
- 2027824..2027891 + 68 NuclAT_28 - -
- 2027824..2027891 + 68 NuclAT_28 - -
- 2027824..2027891 + 68 NuclAT_28 - -
- 2027824..2027891 + 68 NuclAT_28 - -
- 2027824..2027891 + 68 NuclAT_31 - -
- 2027824..2027891 + 68 NuclAT_31 - -
- 2027824..2027891 + 68 NuclAT_31 - -
- 2027824..2027891 + 68 NuclAT_31 - -
- 2027825..2027890 + 66 NuclAT_34 - -
- 2027825..2027890 + 66 NuclAT_34 - -
- 2027825..2027890 + 66 NuclAT_34 - -
- 2027825..2027890 + 66 NuclAT_34 - -
- 2027825..2027890 + 66 NuclAT_36 - -
- 2027825..2027890 + 66 NuclAT_36 - -
- 2027825..2027890 + 66 NuclAT_36 - -
- 2027825..2027890 + 66 NuclAT_36 - -
- 2027825..2027890 + 66 NuclAT_38 - -
- 2027825..2027890 + 66 NuclAT_38 - -
- 2027825..2027890 + 66 NuclAT_38 - -
- 2027825..2027890 + 66 NuclAT_38 - -
- 2027825..2027890 + 66 NuclAT_40 - -
- 2027825..2027890 + 66 NuclAT_40 - -
- 2027825..2027890 + 66 NuclAT_40 - -
- 2027825..2027890 + 66 NuclAT_40 - -
- 2027825..2027890 + 66 NuclAT_42 - -
- 2027825..2027890 + 66 NuclAT_42 - -
- 2027825..2027890 + 66 NuclAT_42 - -
- 2027825..2027890 + 66 NuclAT_42 - -
- 2027825..2027890 + 66 NuclAT_44 - -
- 2027825..2027890 + 66 NuclAT_44 - -
- 2027825..2027890 + 66 NuclAT_44 - -
- 2027825..2027890 + 66 NuclAT_44 - -
C1I23_RS10785 2028204..2028311 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 2028359..2028426 + 68 NuclAT_15 - Antitoxin
- 2028359..2028426 + 68 NuclAT_15 - Antitoxin
- 2028359..2028426 + 68 NuclAT_15 - Antitoxin
- 2028359..2028426 + 68 NuclAT_15 - Antitoxin
- 2028359..2028426 + 68 NuclAT_18 - Antitoxin
- 2028359..2028426 + 68 NuclAT_18 - Antitoxin
- 2028359..2028426 + 68 NuclAT_18 - Antitoxin
- 2028359..2028426 + 68 NuclAT_18 - Antitoxin
- 2028359..2028426 + 68 NuclAT_21 - Antitoxin
- 2028359..2028426 + 68 NuclAT_21 - Antitoxin
- 2028359..2028426 + 68 NuclAT_21 - Antitoxin
- 2028359..2028426 + 68 NuclAT_21 - Antitoxin
- 2028359..2028426 + 68 NuclAT_24 - Antitoxin
- 2028359..2028426 + 68 NuclAT_24 - Antitoxin
- 2028359..2028426 + 68 NuclAT_24 - Antitoxin
- 2028359..2028426 + 68 NuclAT_24 - Antitoxin
- 2028359..2028426 + 68 NuclAT_27 - Antitoxin
- 2028359..2028426 + 68 NuclAT_27 - Antitoxin
- 2028359..2028426 + 68 NuclAT_27 - Antitoxin
- 2028359..2028426 + 68 NuclAT_27 - Antitoxin
- 2028359..2028426 + 68 NuclAT_30 - Antitoxin
- 2028359..2028426 + 68 NuclAT_30 - Antitoxin
- 2028359..2028426 + 68 NuclAT_30 - Antitoxin
- 2028359..2028426 + 68 NuclAT_30 - Antitoxin
C1I23_RS10790 2028715..2029815 - 1101 WP_102597161.1 sodium-potassium/proton antiporter ChaA -
C1I23_RS10795 2030085..2030315 + 231 WP_001146444.1 putative cation transport regulator ChaB -
C1I23_RS10800 2030473..2031168 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
C1I23_RS10805 2031212..2031565 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
C1I23_RS10810 2031750..2033144 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T91871 WP_000170955.1 NZ_CP025747:c2028311-2028204 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T91871 NZ_CP025747:c2028311-2028204 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT91871 NZ_CP025747:2028359-2028426 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References