Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 56742..57006 | Replicon | plasmid pYDC107_85 map unlocalized |
| Accession | NZ_CP025709 | ||
| Organism | Escherichia coli strain YDC107 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | YDC107_RS27025 | Protein ID | WP_001387489.1 |
| Coordinates | 56854..57006 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 56742..56802 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| YDC107_RS27000 (52346) | 52346..52663 | + | 318 | WP_000118520.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
| YDC107_RS27005 (52660) | 52660..53193 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| YDC107_RS27010 (53287) | 53287..54420 | - | 1134 | WP_063859842.1 | extended-spectrum class C beta-lactamase CMY-44 | - |
| YDC107_RS27015 (54744) | 54744..56006 | - | 1263 | WP_000608644.1 | IS1380-like element ISEcp1 family transposase | - |
| YDC107_RS27020 (56159) | 56159..56533 | - | 375 | WP_223349261.1 | hypothetical protein | - |
| - (56742) | 56742..56802 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (56742) | 56742..56802 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (56742) | 56742..56802 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (56742) | 56742..56802 | - | 61 | NuclAT_0 | - | Antitoxin |
| YDC107_RS27025 (56854) | 56854..57006 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| YDC107_RS27030 (56996) | 56996..57208 | - | 213 | WP_050485428.1 | hypothetical protein | - |
| YDC107_RS28710 (57709) | 57709..57804 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| YDC107_RS28260 (57869) | 57869..58045 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| YDC107_RS27040 (58437) | 58437..58646 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| YDC107_RS27045 (58718) | 58718..59380 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| YDC107_RS27050 (59451) | 59451..61619 | - | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-44 | - | 1..85535 | 85535 | |
| - | flank | IS/Tn | blaCMY-44 | - | 53287..56006 | 2719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T91822 WP_001387489.1 NZ_CP025709:56854-57006 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T91822 NZ_CP025709:56854-57006 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT91822 NZ_CP025709:c56802-56742 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
