Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4765608..4765829 Replicon chromosome
Accession NZ_CP025707
Organism Escherichia coli strain YDC107

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag YDC107_RS23235 Protein ID WP_000176713.1
Coordinates 4765608..4765715 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4765763..4765829 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
YDC107_RS23205 4760742..4761824 + 1083 WP_000804726.1 peptide chain release factor 1 -
YDC107_RS23210 4761824..4762657 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
YDC107_RS23215 4762654..4763046 + 393 WP_105955864.1 invasion regulator SirB2 -
YDC107_RS23220 4763050..4763859 + 810 WP_001257044.1 invasion regulator SirB1 -
YDC107_RS23225 4763895..4764749 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
YDC107_RS23230 4764944..4765402 + 459 WP_000526135.1 IS200/IS605 family transposase -
YDC107_RS23235 4765608..4765715 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
YDC107_RS23240 4765723..4765941 + 219 Protein_4528 integrase -
- 4765763..4765829 + 67 NuclAT_21 - Antitoxin
- 4765763..4765829 + 67 NuclAT_21 - Antitoxin
- 4765763..4765829 + 67 NuclAT_21 - Antitoxin
- 4765763..4765829 + 67 NuclAT_21 - Antitoxin
- 4765763..4765829 + 67 NuclAT_26 - Antitoxin
- 4765763..4765829 + 67 NuclAT_26 - Antitoxin
- 4765763..4765829 + 67 NuclAT_26 - Antitoxin
- 4765763..4765829 + 67 NuclAT_26 - Antitoxin
- 4765763..4765829 + 67 NuclAT_31 - Antitoxin
- 4765763..4765829 + 67 NuclAT_31 - Antitoxin
- 4765763..4765829 + 67 NuclAT_31 - Antitoxin
- 4765763..4765829 + 67 NuclAT_31 - Antitoxin
- 4765763..4765829 + 67 NuclAT_36 - Antitoxin
- 4765763..4765829 + 67 NuclAT_36 - Antitoxin
- 4765763..4765829 + 67 NuclAT_36 - Antitoxin
- 4765763..4765829 + 67 NuclAT_36 - Antitoxin
- 4765763..4765829 + 67 NuclAT_38 - Antitoxin
- 4765763..4765829 + 67 NuclAT_38 - Antitoxin
- 4765763..4765829 + 67 NuclAT_38 - Antitoxin
- 4765763..4765829 + 67 NuclAT_38 - Antitoxin
- 4765763..4765829 + 67 NuclAT_43 - Antitoxin
- 4765763..4765829 + 67 NuclAT_43 - Antitoxin
- 4765763..4765829 + 67 NuclAT_43 - Antitoxin
- 4765763..4765829 + 67 NuclAT_43 - Antitoxin
- 4765765..4765828 + 64 NuclAT_46 - -
- 4765765..4765828 + 64 NuclAT_46 - -
- 4765765..4765828 + 64 NuclAT_46 - -
- 4765765..4765828 + 64 NuclAT_46 - -
- 4765765..4765828 + 64 NuclAT_48 - -
- 4765765..4765828 + 64 NuclAT_48 - -
- 4765765..4765828 + 64 NuclAT_48 - -
- 4765765..4765828 + 64 NuclAT_48 - -
YDC107_RS23245 4766143..4766250 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
YDC107_RS23250 4766258..4766477 + 220 Protein_4530 integrase -
- 4766303..4766364 + 62 NuclAT_45 - -
- 4766303..4766364 + 62 NuclAT_45 - -
- 4766303..4766364 + 62 NuclAT_45 - -
- 4766303..4766364 + 62 NuclAT_45 - -
- 4766303..4766364 + 62 NuclAT_47 - -
- 4766303..4766364 + 62 NuclAT_47 - -
- 4766303..4766364 + 62 NuclAT_47 - -
- 4766303..4766364 + 62 NuclAT_47 - -
- 4766303..4766365 + 63 NuclAT_22 - -
- 4766303..4766365 + 63 NuclAT_22 - -
- 4766303..4766365 + 63 NuclAT_22 - -
- 4766303..4766365 + 63 NuclAT_22 - -
- 4766303..4766365 + 63 NuclAT_27 - -
- 4766303..4766365 + 63 NuclAT_27 - -
- 4766303..4766365 + 63 NuclAT_27 - -
- 4766303..4766365 + 63 NuclAT_27 - -
- 4766303..4766365 + 63 NuclAT_32 - -
- 4766303..4766365 + 63 NuclAT_32 - -
- 4766303..4766365 + 63 NuclAT_32 - -
- 4766303..4766365 + 63 NuclAT_32 - -
- 4766303..4766365 + 63 NuclAT_37 - -
- 4766303..4766365 + 63 NuclAT_37 - -
- 4766303..4766365 + 63 NuclAT_37 - -
- 4766303..4766365 + 63 NuclAT_37 - -
- 4766303..4766365 + 63 NuclAT_39 - -
- 4766303..4766365 + 63 NuclAT_39 - -
- 4766303..4766365 + 63 NuclAT_39 - -
- 4766303..4766365 + 63 NuclAT_39 - -
- 4766303..4766365 + 63 NuclAT_44 - -
- 4766303..4766365 + 63 NuclAT_44 - -
- 4766303..4766365 + 63 NuclAT_44 - -
- 4766303..4766365 + 63 NuclAT_44 - -
YDC107_RS23255 4766656..4767756 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
YDC107_RS23260 4768026..4768256 + 231 WP_001146444.1 putative cation transport regulator ChaB -
YDC107_RS23265 4768414..4769109 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
YDC107_RS23270 4769153..4769506 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4764944..4765402 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T91803 WP_000176713.1 NZ_CP025707:c4765715-4765608 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T91803 NZ_CP025707:c4765715-4765608 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT91803 NZ_CP025707:4765763-4765829 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References