Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4014085..4014307 | Replicon | chromosome |
| Accession | NZ_CP025703 | ||
| Organism | Escherichia coli strain BH100N substr. MG2017 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | BH100N_RS20505 | Protein ID | WP_001295224.1 |
| Coordinates | 4014085..4014192 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4014241..4014307 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BH100N_RS20480 | 4009338..4010090 | - | 753 | Protein_3745 | cellulose biosynthesis protein BcsQ | - |
| BH100N_RS20485 | 4010102..4010290 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| BH100N_RS20490 | 4010563..4012134 | + | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
| BH100N_RS20495 | 4012131..4012322 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BH100N_RS20500 | 4012319..4013998 | + | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
| BH100N_RS20505 | 4014085..4014192 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4014241..4014307 | + | 67 | - | - | Antitoxin |
| BH100N_RS20520 | 4014668..4015939 | + | 1272 | WP_001298005.1 | amino acid permease | - |
| BH100N_RS20525 | 4015969..4016973 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BH100N_RS20530 | 4016970..4017953 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| BH100N_RS20535 | 4017964..4018866 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T91761 WP_001295224.1 NZ_CP025703:c4014192-4014085 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T91761 NZ_CP025703:c4014192-4014085 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT91761 NZ_CP025703:4014241-4014307 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|