Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 23910..24168 | Replicon | chromosome |
Accession | NZ_CP025703 | ||
Organism | Escherichia coli strain BH100N substr. MG2017 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | BH100N_RS00130 | Protein ID | WP_000809168.1 |
Coordinates | 23910..24062 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 24111..24168 (+) |
Genomic Context
Location: 20670..22586 (1917 bp)
Type: Others
Protein ID: WP_000516135.1
Type: Others
Protein ID: WP_000516135.1
Location: 22675..23805 (1131 bp)
Type: Others
Protein ID: WP_001118464.1
Type: Others
Protein ID: WP_001118464.1
Location: 24111..24168 (58 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 24677..25438 (762 bp)
Type: Others
Protein ID: WP_099989640.1
Type: Others
Protein ID: WP_099989640.1
Location: 25458..26951 (1494 bp)
Type: Others
Protein ID: WP_001314416.1
Type: Others
Protein ID: WP_001314416.1
Location: 27080..28339 (1260 bp)
Type: Others
Protein ID: WP_000494927.1
Type: Others
Protein ID: WP_000494927.1
Location: 19155..19868 (714 bp)
Type: Others
Protein ID: WP_001102393.1
Type: Others
Protein ID: WP_001102393.1
Location: 19894..20298 (405 bp)
Type: Others
Protein ID: WP_000843689.1
Type: Others
Protein ID: WP_000843689.1
Location: 23910..24062 (153 bp)
Type: Toxin
Protein ID: WP_000809168.1
Type: Toxin
Protein ID: WP_000809168.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BH100N_RS00110 | 19155..19868 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
BH100N_RS00115 | 19894..20298 | - | 405 | WP_000843689.1 | DUF2541 family protein | - |
BH100N_RS00120 | 20670..22586 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
BH100N_RS00125 | 22675..23805 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
BH100N_RS00130 | 23910..24062 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 24111..24168 | + | 58 | - | - | Antitoxin |
BH100N_RS00140 | 24677..25438 | + | 762 | WP_099989640.1 | hypothetical protein | - |
BH100N_RS00145 | 25458..26951 | + | 1494 | WP_001314416.1 | sulfatase-like hydrolase/transferase | - |
BH100N_RS00150 | 27080..28339 | + | 1260 | WP_000494927.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T91738 WP_000809168.1 NZ_CP025703:c24062-23910 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T91738 NZ_CP025703:c24062-23910 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 58 bp
>AT91738 NZ_CP025703:24111-24168 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NX00 |