Detailed information of TA system TA091691

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 35464..35717
• Replicon: plasmid pEA-2
• Accession: NZ_CP025678
• Organism: Escherichia albertii strain ChinaSP140150

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: C0R48_RS26360
• Protein ID: WP_001312851.1
• Coordinates: 35568..35717 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	35464..35523 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C0R48_RS26305	30552..30947	+	396	WP_001309237.1	conjugal transfer relaxosome protein TraY	-
C0R48_RS26310	30980..31339	+	360	WP_059274552.1	type IV conjugative transfer system pilin TraA	-
C0R48_RS26315	31354..31665	+	312	WP_000012106.1	type IV conjugative transfer system protein TraL	-
C0R48_RS26320	31687..31943	+	257	Protein_34	type IV conjugative transfer system protein TraE	-
C0R48_RS26325	31937..32131	+	195	Protein_35	conjugal transfer protein TraC	-
C0R48_RS26330	32133..33756	+	1624	Protein_36	AAA family ATPase	-
C0R48_RS26335	33758..33925	+	168	Protein_37	conjugal transfer protein	-
C0R48_RS26340	33980..34540	+	561	WP_001567328.1	fertility inhibition protein FinO	-
C0R48_RS26345	34676..34888	+	213	WP_032197545.1	ANR family transcriptional regulator	-
C0R48_RS27400	35122..35223	+	102	Protein_40	endonuclease	-
-	35464..35523	-	60	NuclAT_0	-	Antitoxin
-	35464..35523	-	60	NuclAT_0	-	Antitoxin
-	35464..35523	-	60	NuclAT_0	-	Antitoxin
-	35464..35523	-	60	NuclAT_0	-	Antitoxin
C0R48_RS26360	35568..35717	+	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
C0R48_RS26365	36039..36341	+	303	WP_076751484.1	DUF1778 domain-containing protein	-
C0R48_RS26370	36332..36814	+	483	WP_072250165.1	GNAT family N-acetyltransferase	-
C0R48_RS26375	37131..37388	+	258	WP_059274488.1	replication regulatory protein RepA	-
C0R48_RS26385	37621..37695	+	75	WP_001370046.1	RepA leader peptide Tap	-
C0R48_RS26390	37688..38521	+	834	Protein_46	incFII family plasmid replication initiator RepA	-
C0R48_RS26405	39438..39707	+	270	WP_021499564.1	hypothetical protein	-
C0R48_RS26410	39704..39985	+	282	WP_059274487.1	type II toxin-antitoxin system RelE/ParE family toxin	-
C0R48_RS27205	40316..40492	+	177	WP_157941416.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	-	espL2 / espL2 / espL2 / vat	1..57110	57110

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T91691 WP_001312851.1 NZ_CP025678:35568-35717 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T91691 NZ_CP025678:35568-35717 [Escherichia albertii]
ATGACGAAATATGCCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT91691 NZ_CP025678:c35523-35464 [Escherichia albertii]
TAAGTACATCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin