Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 21629..21882 | Replicon | plasmid pEA-1 |
| Accession | NZ_CP025677 | ||
| Organism | Escherichia albertii strain ChinaSP140150 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | C0R48_RS25340 | Protein ID | WP_001312851.1 |
| Coordinates | 21733..21882 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 21629..21688 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C0R48_RS25310 | 18356..19102 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| C0R48_RS25315 | 19157..19717 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| C0R48_RS25320 | 19849..20049 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| C0R48_RS25325 | 20435..21034 | + | 600 | WP_032083981.1 | hypothetical protein | - |
| C0R48_RS25330 | 21198..21428 | + | 231 | WP_001736714.1 | hypothetical protein | - |
| - | 21629..21688 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 21629..21688 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 21629..21688 | - | 60 | NuclAT_1 | - | Antitoxin |
| - | 21629..21688 | - | 60 | NuclAT_1 | - | Antitoxin |
| C0R48_RS25340 | 21733..21882 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C0R48_RS25345 | 22166..22414 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| C0R48_RS25355 | 22659..22733 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| C0R48_RS25360 | 22726..23583 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| C0R48_RS25370 | 24522..25175 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| C0R48_RS27170 | 25268..25525 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| C0R48_RS25375 | 25458..25859 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| C0R48_RS25385 | 26150..26854 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / aph(3')-IIa / oqxB / oqxA / blaCTX-M-55 | - | 1..129356 | 129356 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T91680 WP_001312851.1 NZ_CP025677:21733-21882 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T91680 NZ_CP025677:21733-21882 [Escherichia albertii]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT91680 NZ_CP025677:c21688-21629 [Escherichia albertii]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|