Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 176394..176651 | Replicon | chromosome |
| Accession | NZ_CP025676 | ||
| Organism | Escherichia albertii strain ChinaSP140150 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | C0R48_RS00835 | Protein ID | WP_001135738.1 |
| Coordinates | 176499..176651 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 176394..176442 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C0R48_RS00815 | 171624..172619 | - | 996 | WP_059235567.1 | acyltransferase | - |
| C0R48_RS00820 | 172792..173091 | + | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| C0R48_RS00825 | 173187..174098 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| C0R48_RS00830 | 174108..176177 | + | 2070 | WP_059235569.1 | glycine--tRNA ligase subunit beta | - |
| - | 176394..176442 | - | 49 | - | - | Antitoxin |
| C0R48_RS00835 | 176499..176651 | + | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| C0R48_RS00840 | 176839..177051 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| C0R48_RS00845 | 177334..177624 | - | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| C0R48_RS00850 | 178047..178757 | + | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| C0R48_RS00855 | 178810..179814 | - | 1005 | WP_102203917.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| C0R48_RS00860 | 179887..180546 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T91656 WP_001135738.1 NZ_CP025676:176499-176651 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T91656 NZ_CP025676:176499-176651 [Escherichia albertii]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATTTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGGGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAATTTGAAAGAGTAA
Antitoxin
Download Length: 49 bp
>AT91656 NZ_CP025676:c176442-176394 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|