Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 1530285..1530507 Replicon chromosome
Accession NZ_CP025573
Organism Escherichia coli strain E-1246

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag CY655_RS07545 Protein ID WP_000170955.1
Coordinates 1530285..1530392 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 1530440..1530507 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CY655_RS07510 1525966..1526799 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
CY655_RS07515 1526796..1527188 + 393 WP_000200377.1 invasion regulator SirB2 -
CY655_RS07520 1527192..1528001 + 810 WP_001257044.1 invasion regulator SirB1 -
CY655_RS07525 1528037..1528891 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CY655_RS07535 1529086..1529544 + 459 WP_000526135.1 IS200/IS605 family transposase -
CY655_RS07540 1529750..1529857 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1529905..1529971 + 67 NuclAT_29 - -
- 1529905..1529971 + 67 NuclAT_29 - -
- 1529905..1529971 + 67 NuclAT_29 - -
- 1529905..1529971 + 67 NuclAT_29 - -
- 1529905..1529971 + 67 NuclAT_33 - -
- 1529905..1529971 + 67 NuclAT_33 - -
- 1529905..1529971 + 67 NuclAT_33 - -
- 1529905..1529971 + 67 NuclAT_33 - -
- 1529905..1529971 + 67 NuclAT_37 - -
- 1529905..1529971 + 67 NuclAT_37 - -
- 1529905..1529971 + 67 NuclAT_37 - -
- 1529905..1529971 + 67 NuclAT_37 - -
- 1529905..1529971 + 67 NuclAT_41 - -
- 1529905..1529971 + 67 NuclAT_41 - -
- 1529905..1529971 + 67 NuclAT_41 - -
- 1529905..1529971 + 67 NuclAT_41 - -
- 1529905..1529971 + 67 NuclAT_42 - -
- 1529905..1529971 + 67 NuclAT_42 - -
- 1529905..1529971 + 67 NuclAT_42 - -
- 1529905..1529971 + 67 NuclAT_42 - -
- 1529907..1529972 + 66 NuclAT_11 - -
- 1529907..1529972 + 66 NuclAT_11 - -
- 1529907..1529972 + 66 NuclAT_11 - -
- 1529907..1529972 + 66 NuclAT_11 - -
- 1529907..1529972 + 66 NuclAT_13 - -
- 1529907..1529972 + 66 NuclAT_13 - -
- 1529907..1529972 + 66 NuclAT_13 - -
- 1529907..1529972 + 66 NuclAT_13 - -
- 1529907..1529972 + 66 NuclAT_15 - -
- 1529907..1529972 + 66 NuclAT_15 - -
- 1529907..1529972 + 66 NuclAT_15 - -
- 1529907..1529972 + 66 NuclAT_15 - -
- 1529907..1529972 + 66 NuclAT_17 - -
- 1529907..1529972 + 66 NuclAT_17 - -
- 1529907..1529972 + 66 NuclAT_17 - -
- 1529907..1529972 + 66 NuclAT_17 - -
- 1529907..1529972 + 66 NuclAT_19 - -
- 1529907..1529972 + 66 NuclAT_19 - -
- 1529907..1529972 + 66 NuclAT_19 - -
- 1529907..1529972 + 66 NuclAT_19 - -
- 1529907..1529972 + 66 NuclAT_21 - -
- 1529907..1529972 + 66 NuclAT_21 - -
- 1529907..1529972 + 66 NuclAT_21 - -
- 1529907..1529972 + 66 NuclAT_21 - -
CY655_RS07545 1530285..1530392 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1530440..1530507 + 68 NuclAT_10 - Antitoxin
- 1530440..1530507 + 68 NuclAT_10 - Antitoxin
- 1530440..1530507 + 68 NuclAT_10 - Antitoxin
- 1530440..1530507 + 68 NuclAT_10 - Antitoxin
- 1530440..1530507 + 68 NuclAT_12 - Antitoxin
- 1530440..1530507 + 68 NuclAT_12 - Antitoxin
- 1530440..1530507 + 68 NuclAT_12 - Antitoxin
- 1530440..1530507 + 68 NuclAT_12 - Antitoxin
- 1530440..1530507 + 68 NuclAT_14 - Antitoxin
- 1530440..1530507 + 68 NuclAT_14 - Antitoxin
- 1530440..1530507 + 68 NuclAT_14 - Antitoxin
- 1530440..1530507 + 68 NuclAT_14 - Antitoxin
- 1530440..1530507 + 68 NuclAT_16 - Antitoxin
- 1530440..1530507 + 68 NuclAT_16 - Antitoxin
- 1530440..1530507 + 68 NuclAT_16 - Antitoxin
- 1530440..1530507 + 68 NuclAT_16 - Antitoxin
- 1530440..1530507 + 68 NuclAT_18 - Antitoxin
- 1530440..1530507 + 68 NuclAT_18 - Antitoxin
- 1530440..1530507 + 68 NuclAT_18 - Antitoxin
- 1530440..1530507 + 68 NuclAT_18 - Antitoxin
- 1530440..1530507 + 68 NuclAT_20 - Antitoxin
- 1530440..1530507 + 68 NuclAT_20 - Antitoxin
- 1530440..1530507 + 68 NuclAT_20 - Antitoxin
- 1530440..1530507 + 68 NuclAT_20 - Antitoxin
CY655_RS07550 1530797..1531897 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
CY655_RS07555 1532167..1532397 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CY655_RS07560 1532555..1533250 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CY655_RS07565 1533294..1533647 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CY655_RS07570 1533833..1535227 + 1395 WP_001718153.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1529086..1529544 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T90568 WP_000170955.1 NZ_CP025573:c1530392-1530285 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T90568 NZ_CP025573:c1530392-1530285 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT90568 NZ_CP025573:1530440-1530507 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References