Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 78525..78747 | Replicon | chromosome |
Accession | NZ_CP025520 | ||
Organism | Escherichia coli strain DH5alpha |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | D3H2K1 |
Locus tag | CDN75_RS00525 | Protein ID | WP_000170955.1 |
Coordinates | 78525..78632 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 78680..78747 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CDN75_RS00490 | 74381..75214 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
CDN75_RS00495 | 75211..75603 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
CDN75_RS00500 | 75607..76416 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
CDN75_RS00505 | 76452..77306 | + | 855 | WP_046613400.1 | 3-deoxy-8-phosphooctulonate synthase | - |
CDN75_RS00510 | 77455..77562 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
CDN75_RS00515 | 77990..78097 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
CDN75_RS00525 | 78525..78632 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
- | 78680..78747 | + | 68 | - | - | Antitoxin |
CDN75_RS00530 | 79036..80136 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
CDN75_RS00535 | 80406..80636 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
CDN75_RS00540 | 80794..81489 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
CDN75_RS00545 | 81533..81886 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
CDN75_RS00550 | 82071..83465 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T90470 WP_000170955.1 NZ_CP025520:c78632-78525 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T90470 NZ_CP025520:c78632-78525 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 68 bp
>AT90470 NZ_CP025520:78680-78747 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|