Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2315582..2315764 | Replicon | chromosome |
| Accession | NZ_CP025495 | ||
| Organism | Staphylococcus aureus strain 3020.C01 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | A7U46_RS15375 | Protein ID | WP_001801861.1 |
| Coordinates | 2315669..2315764 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2315582..2315641 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7U46_RS12250 | 2314720..2315097 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| A7U46_RS12255 | 2315291..2315467 | + | 177 | Protein_2254 | transposase | - |
| A7U46_RS12260 | 2315445..2315546 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 2315582..2315641 | + | 60 | - | - | Antitoxin |
| A7U46_RS15375 | 2315669..2315764 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| A7U46_RS12270 | 2315967..2316110 | + | 144 | WP_001549059.1 | transposase | - |
| A7U46_RS12280 | 2316714..2317097 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| A7U46_RS12285 | 2317108..2317284 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| A7U46_RS12290 | 2317286..2317471 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| A7U46_RS12295 | 2317585..2318226 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| A7U46_RS12300 | 2318444..2318995 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| A7U46_RS12305 | 2319093..2319437 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| A7U46_RS12310 | 2319478..2320104 | - | 627 | Protein_2264 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 2282493..2353217 | 70724 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T90447 WP_001801861.1 NZ_CP025495:c2315764-2315669 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T90447 NZ_CP025495:c2315764-2315669 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT90447 NZ_CP025495:2315582-2315641 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|