Detailed information of TA system TA090391

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 125346..125599
• Replicon: plasmid p44-2
• Accession: NZ_CP025463
• Organism: Klebsiella pneumoniae strain F44

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: CYE02_RS30380
• Protein ID: WP_001312851.1
• Coordinates: 125346..125495 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	125540..125599 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CYE02_RS30330	120705..121120	-	416	Protein_161	IS1 family transposase	-
CYE02_RS30345	121369..121770	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
CYE02_RS30985	121703..121960	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
CYE02_RS30350	122053..122706	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
CYE02_RS30360	123645..124502	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
CYE02_RS30365	124495..124569	-	75	WP_001375168.1	RepA leader peptide Tap	-
CYE02_RS30375	124814..125062	-	249	WP_000083837.1	replication regulatory protein RepA	-
CYE02_RS30380	125346..125495	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	125540..125599	+	60	NuclAT_1	-	Antitoxin
-	125540..125599	+	60	NuclAT_1	-	Antitoxin
-	125540..125599	+	60	NuclAT_1	-	Antitoxin
-	125540..125599	+	60	NuclAT_1	-	Antitoxin
CYE02_RS30390	125800..126030	-	231	WP_001736714.1	hypothetical protein	-
CYE02_RS30395	126194..126793	-	600	WP_032083981.1	hypothetical protein	-
CYE02_RS30400	127179..127379	-	201	WP_015059022.1	hypothetical protein	-
CYE02_RS30405	127511..128071	-	561	WP_000139328.1	fertility inhibition protein FinO	-
CYE02_RS30410	128126..128872	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
CYE02_RS30415	128892..129053	-	162	Protein_174	DNA helicase	-
CYE02_RS30420	129117..129821	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
CYE02_RS30425	129874..129939	+	66	Protein_176	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 / catA2	-	1..161580	161580

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T90391 WP_001312851.1 NZ_CP025463:c125495-125346 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T90391 NZ_CP025463:c125495-125346 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT90391 NZ_CP025463:125540-125599 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin