Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 92021..92291 | Replicon | plasmid p69-2 |
Accession | NZ_CP025458 | ||
Organism | Klebsiella pneumoniae strain KP69 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CYD98_RS30590 | Protein ID | WP_001312861.1 |
Coordinates | 92133..92291 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 92021..92084 (-) |
Genomic Context
Location: 87732..88259 (528 bp)
Type: Others
Protein ID: WP_000290834.1
Type: Others
Protein ID: WP_000290834.1
Location: 88317..88550 (234 bp)
Type: Others
Protein ID: WP_000006003.1
Type: Others
Protein ID: WP_000006003.1
Location: 88611..90634 (2024 bp)
Type: Others
Protein ID: Protein_120
Type: Others
Protein ID: Protein_120
Location: 90703..91137 (435 bp)
Type: Others
Protein ID: WP_000845953.1
Type: Others
Protein ID: WP_000845953.1
Location: 91134..91853 (720 bp)
Type: Others
Protein ID: WP_001276217.1
Type: Others
Protein ID: WP_001276217.1
Location: 91865..92089 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 91865..92089 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 91865..92089 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 91865..92089 (225 bp)
Type: Others
Protein ID: NuclAT_0
Type: Others
Protein ID: NuclAT_0
Location: 92133..92291 (159 bp)
Type: Toxin
Protein ID: WP_001312861.1
Type: Toxin
Protein ID: WP_001312861.1
Location: 93206..93502 (297 bp)
Type: Others
Protein ID: WP_001272251.1
Type: Others
Protein ID: WP_001272251.1
Location: 93613..94434 (822 bp)
Type: Others
Protein ID: WP_001234445.1
Type: Others
Protein ID: WP_001234445.1
Location: 95655..96038 (384 bp)
Type: Others
Protein ID: WP_000124981.1
Type: Others
Protein ID: WP_000124981.1
Location: 96229..96915 (687 bp)
Type: Others
Protein ID: WP_015059009.1
Type: Others
Protein ID: WP_015059009.1
Location: 97009..97236 (228 bp)
Type: Others
Protein ID: WP_001254386.1
Type: Others
Protein ID: WP_001254386.1
Location: 92021..92084 (64 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 92529..92906 (378 bp)
Type: Others
Protein ID: Protein_124
Type: Others
Protein ID: Protein_124
Location: 94731..95378 (648 bp)
Type: Others
Protein ID: WP_015059008.1
Type: Others
Protein ID: WP_015059008.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CYD98_RS29970 | 87732..88259 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
CYD98_RS29975 | 88317..88550 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
CYD98_RS29980 | 88611..90634 | + | 2024 | Protein_120 | ParB/RepB/Spo0J family partition protein | - |
CYD98_RS29985 | 90703..91137 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
CYD98_RS29990 | 91134..91853 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 91865..92089 | + | 225 | NuclAT_0 | - | - |
- | 91865..92089 | + | 225 | NuclAT_0 | - | - |
- | 91865..92089 | + | 225 | NuclAT_0 | - | - |
- | 91865..92089 | + | 225 | NuclAT_0 | - | - |
- | 92021..92084 | - | 64 | - | - | Antitoxin |
CYD98_RS30590 | 92133..92291 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
CYD98_RS31240 | 92529..92906 | - | 378 | Protein_124 | hypothetical protein | - |
CYD98_RS30015 | 93206..93502 | + | 297 | WP_001272251.1 | hypothetical protein | - |
CYD98_RS30020 | 93613..94434 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
CYD98_RS30025 | 94731..95378 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
CYD98_RS30030 | 95655..96038 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
CYD98_RS30035 | 96229..96915 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
CYD98_RS30040 | 97009..97236 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | catA2 / blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..128563 | 128563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T90358 WP_001312861.1 NZ_CP025458:92133-92291 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T90358 NZ_CP025458:92133-92291 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT90358 NZ_CP025458:c92084-92021 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | P11895 |
Antitoxin
Download structure file