Detailed information of TA system TA090354

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 60343..60596
• Replicon: plasmid p69-2
• Accession: NZ_CP025458
• Organism: Klebsiella pneumoniae strain KP69

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: CYD98_RS29720
• Protein ID: WP_001312851.1
• Coordinates: 60343..60492 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	60537..60596 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
CYD98_RS29670	55702..56117	-	416	Protein_74	IS1 family transposase	-
CYD98_RS29685	56366..56767	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
CYD98_RS30585	56700..56957	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
CYD98_RS29690	57050..57703	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
CYD98_RS29700	58642..59499	-	858	WP_142295464.1	incFII family plasmid replication initiator RepA	-
CYD98_RS29705	59492..59566	-	75	WP_001375168.1	RepA leader peptide Tap	-
CYD98_RS29715	59811..60059	-	249	WP_000083837.1	replication regulatory protein RepA	-
CYD98_RS29720	60343..60492	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	60537..60596	+	60	NuclAT_1	-	Antitoxin
-	60537..60596	+	60	NuclAT_1	-	Antitoxin
-	60537..60596	+	60	NuclAT_1	-	Antitoxin
-	60537..60596	+	60	NuclAT_1	-	Antitoxin
CYD98_RS29730	60797..61027	-	231	WP_001736714.1	hypothetical protein	-
CYD98_RS29735	61191..61790	-	600	WP_032083981.1	hypothetical protein	-
CYD98_RS29740	62176..62376	-	201	WP_015059022.1	hypothetical protein	-
CYD98_RS29745	62508..63068	-	561	WP_000139328.1	fertility inhibition protein FinO	-
CYD98_RS29750	63123..63869	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
CYD98_RS29755	63889..64050	-	162	Protein_87	DNA helicase	-
CYD98_RS29760	64114..64818	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
CYD98_RS29765	64871..64936	+	66	Protein_89	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	catA2 / blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2	-	1..128563	128563

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T90354 WP_001312851.1 NZ_CP025458:c60492-60343 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T90354 NZ_CP025458:c60492-60343 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT90354 NZ_CP025458:60537-60596 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin