Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 2519876..2520024 | Replicon | chromosome |
| Accession | NZ_CP025396 | ||
| Organism | Staphylococcus haemolyticus strain B | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | CYD28_RS12775 | Protein ID | WP_011276848.1 |
| Coordinates | 2519929..2520024 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2519876..2519911 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CYD28_RS12215 | 2515552..2515689 | - | 138 | Protein_2347 | NAD(P)H-dependent oxidoreductase | - |
| CYD28_RS12220 | 2515831..2516961 | - | 1131 | WP_033080168.1 | NADH-dependent flavin oxidoreductase | - |
| CYD28_RS12225 | 2517163..2517585 | - | 423 | WP_033080167.1 | MarR family transcriptional regulator | - |
| CYD28_RS12230 | 2518229..2518831 | - | 603 | WP_011276850.1 | hypothetical protein | - |
| CYD28_RS12235 | 2519043..2519735 | - | 693 | WP_103416071.1 | nucleotidyltransferase | - |
| - | 2519876..2519911 | - | 36 | - | - | Antitoxin |
| CYD28_RS12775 | 2519929..2520024 | - | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CYD28_RS12780 | 2520219..2520467 | - | 249 | WP_002440480.1 | hypothetical protein | - |
| CYD28_RS12240 | 2520489..2520793 | - | 305 | Protein_2354 | hypothetical protein | - |
| CYD28_RS12245 | 2520932..2521315 | - | 384 | WP_011276846.1 | effector binding domain-containing protein | - |
| CYD28_RS12250 | 2521555..2522085 | - | 531 | WP_011276845.1 | N-acetyltransferase | - |
| CYD28_RS12905 | 2522689..2522946 | - | 258 | Protein_2357 | replication initiation protein | - |
| CYD28_RS12265 | 2523639..2523956 | + | 318 | Protein_2358 | IS200/IS605-like element ISSep3 family transposase | - |
| CYD28_RS12270 | 2524064..2524297 | - | 234 | WP_016931184.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2523639..2523959 | 320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T90265 WP_011276848.1 NZ_CP025396:c2520024-2519929 [Staphylococcus haemolyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T90265 NZ_CP025396:c2520024-2519929 [Staphylococcus haemolyticus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT90265 NZ_CP025396:c2519911-2519876 [Staphylococcus haemolyticus]
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|