Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2483607..2483791 | Replicon | chromosome |
Accession | NZ_CP025395 | ||
Organism | Staphylococcus aureus O46 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAO46_RS12800 | Protein ID | WP_000482647.1 |
Coordinates | 2483684..2483791 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2483607..2483667 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAO46_RS12775 | 2479061..2479228 | - | 168 | WP_031901225.1 | hypothetical protein | - |
SAO46_RS12785 | 2479459..2481192 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
SAO46_RS12790 | 2481217..2482980 | - | 1764 | WP_001064823.1 | ABC transporter ATP-binding protein/permease | - |
- | 2483607..2483667 | + | 61 | - | - | Antitoxin |
SAO46_RS12800 | 2483684..2483791 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAO46_RS12805 | 2483925..2484311 | - | 387 | WP_000779350.1 | flippase GtxA | - |
SAO46_RS12810 | 2484579..2485721 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
SAO46_RS12815 | 2485781..2486440 | + | 660 | WP_000831298.1 | membrane protein | - |
SAO46_RS12820 | 2486623..2487834 | + | 1212 | WP_001191929.1 | multidrug effflux MFS transporter | - |
SAO46_RS12825 | 2487957..2488430 | - | 474 | WP_000456488.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T90259 WP_000482647.1 NZ_CP025395:c2483791-2483684 [Staphylococcus aureus O46]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T90259 NZ_CP025395:c2483791-2483684 [Staphylococcus aureus O46]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT90259 NZ_CP025395:2483607-2483667 [Staphylococcus aureus O46]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|