Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1870151..1870331 | Replicon | chromosome |
Accession | NZ_CP025395 | ||
Organism | Staphylococcus aureus O46 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAO46_RS14325 | Protein ID | WP_001801861.1 |
Coordinates | 1870151..1870246 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1870274..1870331 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAO46_RS09255 | 1865219..1865791 | + | 573 | WP_000414228.1 | hypothetical protein | - |
SAO46_RS09260 | 1866167..1867003 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
SAO46_RS09270 | 1867809..1867994 | - | 186 | WP_000809858.1 | hypothetical protein | - |
SAO46_RS09275 | 1867996..1868172 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAO46_RS09280 | 1868183..1868566 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAO46_RS09285 | 1869253..1869699 | - | 447 | WP_000747809.1 | DUF1433 domain-containing protein | - |
SAO46_RS14325 | 1870151..1870246 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1870274..1870331 | - | 58 | - | - | Antitoxin |
SAO46_RS09295 | 1870369..1870470 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAO46_RS09300 | 1870508..1870624 | - | 117 | Protein_1762 | transposase | - |
SAO46_RS09305 | 1871133..1875244 | - | 4112 | Protein_1763 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1861550..1891572 | 30022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T90253 WP_001801861.1 NZ_CP025395:1870151-1870246 [Staphylococcus aureus O46]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T90253 NZ_CP025395:1870151-1870246 [Staphylococcus aureus O46]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT90253 NZ_CP025395:c1870331-1870274 [Staphylococcus aureus O46]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|