Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 191814..192083 | Replicon | plasmid unnamed |
| Accession | NZ_CP025329 | ||
| Organism | Escherichia coli strain ExPEC XM | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CXG97_RS27900 | Protein ID | WP_001312861.1 |
| Coordinates | 191925..192083 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 191814..191879 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXG97_RS27870 | 187589..188128 | + | 540 | WP_009426937.1 | single-stranded DNA-binding protein | - |
| CXG97_RS27875 | 188184..188417 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| CXG97_RS27880 | 188482..190440 | + | 1959 | WP_101357017.1 | ParB/RepB/Spo0J family partition protein | - |
| CXG97_RS27885 | 190495..190929 | + | 435 | WP_000845930.1 | conjugation system SOS inhibitor PsiB | - |
| CXG97_RS27890 | 190926..191645 | + | 720 | WP_021573167.1 | plasmid SOS inhibition protein A | - |
| - | 191657..191881 | + | 225 | NuclAT_0 | - | - |
| - | 191657..191881 | + | 225 | NuclAT_0 | - | - |
| - | 191657..191881 | + | 225 | NuclAT_0 | - | - |
| - | 191657..191881 | + | 225 | NuclAT_0 | - | - |
| - | 191814..191879 | + | 66 | - | - | Antitoxin |
| CXG97_RS27900 | 191925..192083 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| CXG97_RS29050 | 192437..192649 | - | 213 | WP_162491396.1 | hypothetical protein | - |
| CXG97_RS27920 | 193005..193292 | + | 288 | WP_101357019.1 | hypothetical protein | - |
| CXG97_RS27925 | 193411..194232 | + | 822 | WP_145607291.1 | DUF945 domain-containing protein | - |
| CXG97_RS27930 | 194529..195176 | - | 648 | WP_000614934.1 | transglycosylase SLT domain-containing protein | - |
| CXG97_RS27935 | 195442..195825 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| CXG97_RS27940 | 196016..196702 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| CXG97_RS27945 | 196796..197023 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / aph(6)-Id / aph(3'')-Ib / tet(A) | vat / iroN / iroE / iroD / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..286854 | 286854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T90135 WP_001312861.1 NZ_CP025329:191925-192083 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T90135 NZ_CP025329:191925-192083 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT90135 NZ_CP025329:191814-191879 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|