Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3700668..3700890 | Replicon | chromosome |
Accession | NZ_CP025268 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1E8T8 |
Locus tag | CXP41_RS19295 | Protein ID | WP_000141634.1 |
Coordinates | 3700668..3700775 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3700824..3700890 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CXP41_RS19270 | 3695921..3696673 | - | 753 | Protein_3530 | cellulose biosynthesis protein BcsQ | - |
CXP41_RS19275 | 3696685..3696873 | - | 189 | WP_001063318.1 | YhjR family protein | - |
CXP41_RS19280 | 3697146..3698717 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
CXP41_RS19285 | 3698714..3698905 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
CXP41_RS19290 | 3698902..3700581 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
CXP41_RS19295 | 3700668..3700775 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
- | 3700824..3700890 | + | 67 | - | - | Antitoxin |
CXP41_RS19310 | 3701251..3702522 | + | 1272 | WP_001295225.1 | transporter | - |
CXP41_RS19315 | 3702552..3703556 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
CXP41_RS19320 | 3703553..3704536 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
CXP41_RS19325 | 3704547..3705449 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T90014 WP_000141634.1 NZ_CP025268:c3700775-3700668 [Escherichia coli str. K-12 substr. MG1655]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T90014 NZ_CP025268:c3700775-3700668 [Escherichia coli str. K-12 substr. MG1655]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT90014 NZ_CP025268:3700824-3700890 [Escherichia coli str. K-12 substr. MG1655]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|