Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1276255..1276477 Replicon chromosome
Accession NZ_CP025268
Organism Escherichia coli str. K-12 substr. MG1655 strain K-12

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag CXP41_RS06760 Protein ID WP_000170955.1
Coordinates 1276255..1276362 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1276410..1276477 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CXP41_RS06725 1272111..1272944 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
CXP41_RS06730 1272941..1273333 + 393 WP_000200374.1 invasion regulator SirB2 -
CXP41_RS06735 1273337..1274146 + 810 WP_001257044.1 invasion regulator SirB1 -
CXP41_RS06740 1274182..1275036 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CXP41_RS06745 1275185..1275292 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1275340..1275406 + 67 NuclAT_34 - -
- 1275340..1275406 + 67 NuclAT_34 - -
- 1275340..1275406 + 67 NuclAT_34 - -
- 1275340..1275406 + 67 NuclAT_34 - -
- 1275340..1275406 + 67 NuclAT_36 - -
- 1275340..1275406 + 67 NuclAT_36 - -
- 1275340..1275406 + 67 NuclAT_36 - -
- 1275340..1275406 + 67 NuclAT_36 - -
- 1275340..1275406 + 67 NuclAT_38 - -
- 1275340..1275406 + 67 NuclAT_38 - -
- 1275340..1275406 + 67 NuclAT_38 - -
- 1275340..1275406 + 67 NuclAT_38 - -
- 1275340..1275406 + 67 NuclAT_40 - -
- 1275340..1275406 + 67 NuclAT_40 - -
- 1275340..1275406 + 67 NuclAT_40 - -
- 1275340..1275406 + 67 NuclAT_40 - -
- 1275340..1275406 + 67 NuclAT_42 - -
- 1275340..1275406 + 67 NuclAT_42 - -
- 1275340..1275406 + 67 NuclAT_42 - -
- 1275340..1275406 + 67 NuclAT_42 - -
- 1275340..1275406 + 67 NuclAT_44 - -
- 1275340..1275406 + 67 NuclAT_44 - -
- 1275340..1275406 + 67 NuclAT_44 - -
- 1275340..1275406 + 67 NuclAT_44 - -
- 1275342..1275407 + 66 NuclAT_18 - -
- 1275342..1275407 + 66 NuclAT_18 - -
- 1275342..1275407 + 66 NuclAT_18 - -
- 1275342..1275407 + 66 NuclAT_18 - -
- 1275342..1275407 + 66 NuclAT_21 - -
- 1275342..1275407 + 66 NuclAT_21 - -
- 1275342..1275407 + 66 NuclAT_21 - -
- 1275342..1275407 + 66 NuclAT_21 - -
- 1275342..1275407 + 66 NuclAT_24 - -
- 1275342..1275407 + 66 NuclAT_24 - -
- 1275342..1275407 + 66 NuclAT_24 - -
- 1275342..1275407 + 66 NuclAT_24 - -
- 1275342..1275407 + 66 NuclAT_27 - -
- 1275342..1275407 + 66 NuclAT_27 - -
- 1275342..1275407 + 66 NuclAT_27 - -
- 1275342..1275407 + 66 NuclAT_27 - -
- 1275342..1275407 + 66 NuclAT_30 - -
- 1275342..1275407 + 66 NuclAT_30 - -
- 1275342..1275407 + 66 NuclAT_30 - -
- 1275342..1275407 + 66 NuclAT_30 - -
- 1275342..1275407 + 66 NuclAT_33 - -
- 1275342..1275407 + 66 NuclAT_33 - -
- 1275342..1275407 + 66 NuclAT_33 - -
- 1275342..1275407 + 66 NuclAT_33 - -
CXP41_RS06750 1275720..1275827 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1275875..1275942 + 68 NuclAT_17 - -
- 1275875..1275942 + 68 NuclAT_17 - -
- 1275875..1275942 + 68 NuclAT_17 - -
- 1275875..1275942 + 68 NuclAT_17 - -
- 1275875..1275942 + 68 NuclAT_20 - -
- 1275875..1275942 + 68 NuclAT_20 - -
- 1275875..1275942 + 68 NuclAT_20 - -
- 1275875..1275942 + 68 NuclAT_20 - -
- 1275875..1275942 + 68 NuclAT_23 - -
- 1275875..1275942 + 68 NuclAT_23 - -
- 1275875..1275942 + 68 NuclAT_23 - -
- 1275875..1275942 + 68 NuclAT_23 - -
- 1275875..1275942 + 68 NuclAT_26 - -
- 1275875..1275942 + 68 NuclAT_26 - -
- 1275875..1275942 + 68 NuclAT_26 - -
- 1275875..1275942 + 68 NuclAT_26 - -
- 1275875..1275942 + 68 NuclAT_29 - -
- 1275875..1275942 + 68 NuclAT_29 - -
- 1275875..1275942 + 68 NuclAT_29 - -
- 1275875..1275942 + 68 NuclAT_29 - -
- 1275875..1275942 + 68 NuclAT_32 - -
- 1275875..1275942 + 68 NuclAT_32 - -
- 1275875..1275942 + 68 NuclAT_32 - -
- 1275875..1275942 + 68 NuclAT_32 - -
- 1275876..1275941 + 66 NuclAT_35 - -
- 1275876..1275941 + 66 NuclAT_35 - -
- 1275876..1275941 + 66 NuclAT_35 - -
- 1275876..1275941 + 66 NuclAT_35 - -
- 1275876..1275941 + 66 NuclAT_37 - -
- 1275876..1275941 + 66 NuclAT_37 - -
- 1275876..1275941 + 66 NuclAT_37 - -
- 1275876..1275941 + 66 NuclAT_37 - -
- 1275876..1275941 + 66 NuclAT_39 - -
- 1275876..1275941 + 66 NuclAT_39 - -
- 1275876..1275941 + 66 NuclAT_39 - -
- 1275876..1275941 + 66 NuclAT_39 - -
- 1275876..1275941 + 66 NuclAT_41 - -
- 1275876..1275941 + 66 NuclAT_41 - -
- 1275876..1275941 + 66 NuclAT_41 - -
- 1275876..1275941 + 66 NuclAT_41 - -
- 1275876..1275941 + 66 NuclAT_43 - -
- 1275876..1275941 + 66 NuclAT_43 - -
- 1275876..1275941 + 66 NuclAT_43 - -
- 1275876..1275941 + 66 NuclAT_43 - -
- 1275876..1275941 + 66 NuclAT_45 - -
- 1275876..1275941 + 66 NuclAT_45 - -
- 1275876..1275941 + 66 NuclAT_45 - -
- 1275876..1275941 + 66 NuclAT_45 - -
CXP41_RS06760 1276255..1276362 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1276410..1276477 + 68 NuclAT_16 - Antitoxin
- 1276410..1276477 + 68 NuclAT_16 - Antitoxin
- 1276410..1276477 + 68 NuclAT_16 - Antitoxin
- 1276410..1276477 + 68 NuclAT_16 - Antitoxin
- 1276410..1276477 + 68 NuclAT_19 - Antitoxin
- 1276410..1276477 + 68 NuclAT_19 - Antitoxin
- 1276410..1276477 + 68 NuclAT_19 - Antitoxin
- 1276410..1276477 + 68 NuclAT_19 - Antitoxin
- 1276410..1276477 + 68 NuclAT_22 - Antitoxin
- 1276410..1276477 + 68 NuclAT_22 - Antitoxin
- 1276410..1276477 + 68 NuclAT_22 - Antitoxin
- 1276410..1276477 + 68 NuclAT_22 - Antitoxin
- 1276410..1276477 + 68 NuclAT_25 - Antitoxin
- 1276410..1276477 + 68 NuclAT_25 - Antitoxin
- 1276410..1276477 + 68 NuclAT_25 - Antitoxin
- 1276410..1276477 + 68 NuclAT_25 - Antitoxin
- 1276410..1276477 + 68 NuclAT_28 - Antitoxin
- 1276410..1276477 + 68 NuclAT_28 - Antitoxin
- 1276410..1276477 + 68 NuclAT_28 - Antitoxin
- 1276410..1276477 + 68 NuclAT_28 - Antitoxin
- 1276410..1276477 + 68 NuclAT_31 - Antitoxin
- 1276410..1276477 + 68 NuclAT_31 - Antitoxin
- 1276410..1276477 + 68 NuclAT_31 - Antitoxin
- 1276410..1276477 + 68 NuclAT_31 - Antitoxin
CXP41_RS06765 1276766..1277866 - 1101 WP_101348582.1 sodium-potassium/proton antiporter ChaA -
CXP41_RS06770 1278136..1278366 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CXP41_RS06775 1278524..1279219 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
CXP41_RS06780 1279263..1279616 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
CXP41_RS06785 1279801..1281195 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T89987 WP_000170955.1 NZ_CP025268:c1276362-1276255 [Escherichia coli str. K-12 substr. MG1655]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T89987 NZ_CP025268:c1276362-1276255 [Escherichia coli str. K-12 substr. MG1655]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT89987 NZ_CP025268:1276410-1276477 [Escherichia coli str. K-12 substr. MG1655]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References