Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50483..50753 | Replicon | plasmid pBH100-1 |
| Accession | NZ_CP025253 | ||
| Organism | Escherichia coli strain BH100 substr. MG2017 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BH100B_RS26685 | Protein ID | WP_001312861.1 |
| Coordinates | 50595..50753 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 50483..50546 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BH100B_RS26650 | 46105..46698 | - | 594 | WP_000428546.1 | tetracyline resistance-associated transcriptional repressor TetC | - |
| BH100B_RS26655 | 46831..47202 | + | 372 | WP_035689358.1 | helix-turn-helix domain-containing protein | - |
| BH100B_RS26660 | 47212..48419 | - | 1208 | Protein_53 | IS4 family transposase | - |
| BH100B_RS26670 | 48529..49110 | + | 582 | Protein_54 | hypothetical protein | - |
| BH100B_RS26675 | 49165..49599 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| BH100B_RS26680 | 49596..50315 | + | 720 | WP_000116348.1 | plasmid SOS inhibition protein A | - |
| - | 50327..50551 | + | 225 | NuclAT_0 | - | - |
| - | 50327..50551 | + | 225 | NuclAT_0 | - | - |
| - | 50327..50551 | + | 225 | NuclAT_0 | - | - |
| - | 50327..50551 | + | 225 | NuclAT_0 | - | - |
| BH100B_RS27295 | 50336..50515 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 50483..50546 | - | 64 | - | - | Antitoxin |
| BH100B_RS26685 | 50595..50753 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BH100B_RS27455 | 50991..51368 | - | 378 | Protein_59 | hypothetical protein | - |
| BH100B_RS26705 | 51668..51964 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| BH100B_RS26710 | 52075..52896 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| BH100B_RS26715 | 53193..53795 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| BH100B_RS26725 | 54118..54501 | + | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| BH100B_RS26730 | 54695..55366 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| BH100B_RS26735 | 55503..55730 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / ant(3'')-Ia / catA1 / aph(3')-Ia / tet(B) / blaTEM-1A | - | 1..105801 | 105801 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T89961 WP_001312861.1 NZ_CP025253:50595-50753 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T89961 NZ_CP025253:50595-50753 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT89961 NZ_CP025253:c50546-50483 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|