Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3983767..3983989 | Replicon | chromosome |
| Accession | NZ_CP025251 | ||
| Organism | Escherichia coli strain BH100 substr. MG2017 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | BH100B_RS20270 | Protein ID | WP_001295224.1 |
| Coordinates | 3983767..3983874 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3983923..3983989 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BH100B_RS20245 | 3979020..3979772 | - | 753 | Protein_3706 | cellulose biosynthesis protein BcsQ | - |
| BH100B_RS20250 | 3979784..3979972 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| BH100B_RS20255 | 3980245..3981816 | + | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
| BH100B_RS20260 | 3981813..3982004 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BH100B_RS20265 | 3982001..3983680 | + | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
| BH100B_RS20270 | 3983767..3983874 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3983923..3983989 | + | 67 | - | - | Antitoxin |
| BH100B_RS20285 | 3984350..3985621 | + | 1272 | WP_001298005.1 | amino acid permease | - |
| BH100B_RS20290 | 3985651..3986655 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BH100B_RS20295 | 3986652..3987635 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| BH100B_RS20300 | 3987646..3988548 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T89952 WP_001295224.1 NZ_CP025251:c3983874-3983767 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T89952 NZ_CP025251:c3983874-3983767 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT89952 NZ_CP025251:3983923-3983989 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|