Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 993249..993397 | Replicon | chromosome |
Accession | NZ_CP025031 | ||
Organism | Staphylococcus haemolyticus strain SGAir0252 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | CWR44_RS04830 | Protein ID | WP_011276848.1 |
Coordinates | 993302..993397 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 993249..993284 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CWR44_RS04805 | 988533..990290 | - | 1758 | WP_001096374.1 | beta-lactam sensor/signal transducer BlaR1 | - |
CWR44_RS04810 | 990397..991242 | + | 846 | WP_000733283.1 | BlaZ family penicillin-hydrolyzing class A beta-lactamase PC1 | - |
CWR44_RS04820 | 991601..992203 | - | 603 | WP_011276850.1 | hypothetical protein | - |
CWR44_RS04825 | 992449..993108 | - | 660 | WP_011276849.1 | nucleotidyltransferase | - |
- | 993249..993284 | - | 36 | - | - | Antitoxin |
CWR44_RS04830 | 993302..993397 | - | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CWR44_RS13300 | 993592..993738 | - | 147 | WP_000668388.1 | hypothetical protein | - |
CWR44_RS04835 | 993862..994166 | - | 305 | Protein_949 | hypothetical protein | - |
CWR44_RS04840 | 994305..994688 | - | 384 | WP_011276846.1 | effector binding domain-containing protein | - |
CWR44_RS04845 | 994928..995458 | - | 531 | WP_011276845.1 | N-acetyltransferase | - |
CWR44_RS13305 | 996062..996319 | - | 258 | Protein_952 | replication initiation protein | - |
CWR44_RS04860 | 997012..997329 | + | 318 | Protein_953 | IS200/IS605-like element ISSep3 family transposase | - |
CWR44_RS04865 | 997437..997670 | - | 234 | WP_016931184.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | SCCmec | aac(6')-aph(2'') / blaZ | clpC / tufA / clpP | 961943..1495954 | 534011 | |
- | flank | IS/Tn | - | - | 997012..997332 | 320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T89542 WP_011276848.1 NZ_CP025031:c993397-993302 [Staphylococcus haemolyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T89542 NZ_CP025031:c993397-993302 [Staphylococcus haemolyticus]
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
ATGTTGGAAATCCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTATTATTGCGTTATTTACGCATTGGCTGCGTAA
TCGCAAAGACAAATAG
Antitoxin
Download Length: 36 bp
>AT89542 NZ_CP025031:c993284-993249 [Staphylococcus haemolyticus]
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAACAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|