Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 1950565..1950749 | Replicon | chromosome |
Accession | NZ_CP024998 | ||
Organism | Staphylococcus aureus strain 55-99-44 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2K4AFL5 |
Locus tag | CU118_RS10130 | Protein ID | WP_000482651.1 |
Coordinates | 1950642..1950749 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 1950565..1950625 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CU118_RS10100 | 1946109..1947224 | - | 1116 | WP_054189927.1 | pyridoxal phosphate-dependent aminotransferase family protein | - |
CU118_RS10105 | 1947202..1948209 | - | 1008 | WP_001046647.1 | biotin synthase BioB | - |
CU118_RS10110 | 1948211..1949569 | - | 1359 | WP_054189926.1 | adenosylmethionine--8-amino-7-oxononanoate transaminase | - |
CU118_RS10115 | 1949547..1950233 | - | 687 | WP_054189925.1 | dethiobiotin synthase | - |
CU118_RS10120 | 1950288..1950455 | - | 168 | Protein_1887 | hypothetical protein | - |
- | 1950565..1950625 | + | 61 | - | - | Antitoxin |
CU118_RS10130 | 1950642..1950749 | - | 108 | WP_000482651.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CU118_RS10135 | 1950883..1951269 | - | 387 | WP_054189924.1 | flippase GtxA | - |
CU118_RS10140 | 1951537..1952679 | + | 1143 | WP_054189923.1 | glycerate kinase | - |
CU118_RS10145 | 1952739..1953392 | + | 654 | WP_054189922.1 | hypothetical protein | - |
CU118_RS10150 | 1953574..1954785 | + | 1212 | WP_054189921.1 | multidrug effflux MFS transporter | - |
CU118_RS10155 | 1954909..1955382 | - | 474 | WP_054189920.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3984.75 Da Isoelectric Point: 11.0582
>T89439 WP_000482651.1 NZ_CP024998:c1950749-1950642 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRSNKKGDK
Download Length: 108 bp
>T89439 NZ_CP024998:c1950749-1950642 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGTGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGTGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT89439 NZ_CP024998:1950565-1950625 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTATTGCCGTAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|